KEGG   Burkholderia thailandensis E264: BTH_I0476Help
Entry
BTH_I0476         CDS       T00311                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bte  Burkholderia thailandensis E264
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BTH_I0476 (ipk)
Enzymes [BR:bte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BTH_I0476 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(528512..529393)
Genome map
AA seq 293 aa AA seqDB search
MTDTTRSLRDCLAPAKLNLFLHITGRRPDGYHELQSVFQLLDWGDRLHFTLRDDGKVSRK
TDVPGVPEETDLIVRAASLLKAHTGTAAGVDIEIDKRLPMGAGLGGGSSDAATTLLALNR
LWKLDLPRATLQSLAVKLGADVPFFVFGKNAFAEGIGEALQAVELPTRWFLVVTPRVHVP
TAAIFSEKSLTRDSKPITITDFLAQQDCNTGWPDSFGRNDMQPVVTSKYAEVAKVVGWFY
NLTPARMTGSGASVFAAFKSKAEAGAAQAQLPAGWDSAVAESLGEHPLFAFAS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatacgacccgctcgctgcgcgactgcctcgccccggcgaaactgaacctgttc
ctgcacatcacgggccgtcgtccggacggctatcacgagctgcaaagcgtgttccagctg
ctcgactggggcgaccggctgcacttcacgctgcgcgacgacggcaaggtgtcgcgcaag
accgacgtgccgggcgtacccgaggaaaccgacctcatcgtgcgcgcggcgtcgctgctg
aaagcgcacacgggcacggcggcgggcgtcgacatcgagatcgacaagcgactgccgatg
ggcgcgggcctcggcggaggcagctcggatgcggcgacgacgttgctcgcgctcaaccgc
ctctggaagctcgacttgccgcgcgccacgctgcaatcgctcgcggtgaagctcggcgcc
gacgtgccgttcttcgtcttcggaaaaaatgcgttcgcagagggtatcggagaagcgctg
caagctgtagaattgccgactcgctggtttctggttgtgacaccgcgggttcacgttccg
accgcagcgattttttccgaaaaatcgttgacaagagattcgaaacccatcacaattacg
gactttcttgcacagcaagactgcaacacgggatggcctgacagtttcggtcggaatgac
atgcagccggttgtgacaagcaagtacgcggaagttgcaaaggtggtcggatggttttat
aatctgacccccgcgcggatgaccggctccggagctagcgtgtttgcagcgttcaagagc
aaggcggaggcaggagcggcgcaagcccaactgccggccggctgggacagcgcagttgcc
gagagcttgggtgagcatccactcttcgctttcgcgtcataa

DBGET integrated database retrieval system