KEGG   Burkholderia thailandensis E264: BTH_I0775Help
Entry
BTH_I0775         CDS       T00311                                 

Definition
(GenBank) fatty acid desaturase family protein
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte01040  Biosynthesis of unsaturated fatty acids
bte01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BTH_I0775
Enzymes [BR:bte01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BTH_I0775
Lipid biosynthesis proteins [BR:bte01004]
 Desaturase
  First
   BTH_I0775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3 DUF4375
Motif
Other DBs
NCBI-ProteinID: ABC38864
UniProt: Q2T0G8
Position
I:892901..894094
Genome map
AA seq 397 aa AA seqDB search
MNSLLDFLSNGLLRFSWWQVVLFTLAVTHVTIVGVTVYLHRCQAHRALDLHPVMSHFFRL
WLWMTTGMLTGQWAAIHRKHHAKCETEEDPHSPQTRGIWKVLLEGAELYRAEAKNEETMR
KYGHGTPNDWLERNLYSKYPILGVSLMMVIDVALFGVVGLTVWAVQMVWIPFWAAGVVNG
LGHFWGYRNFNAADASTNLFPWGIVIGGEELHNNHHTFATSAKLSNKWYEFDIGWMYIRI
MSAFGLAKVKKIAPTPRLAARKTVLDQETLQAVLSNRYEVMARYAKTLKRAYRQELVHLK
ELGAREKYQLMRGARKWFHKEEAGLDEPQKRMLPEIFANSQKLHTFFQLRTELAAIWERS
NASRDQLLAQLQDWCHRAEQSGIKALQEFATRLRRYA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
ttgaattccctgctcgatttcctttccaacgggcttctgcgtttctcgtggtggcaggtc
gtgctgttcacgctcgccgtcacgcacgtgacgatcgtcggcgtgacggtctatttgcat
cgctgccaggcgcaccgcgcgctcgatctgcatccggtcatgagccacttcttccgcctg
tggttgtggatgacgacgggcatgctgacgggccagtgggcggcgatccatcgcaagcac
catgcgaagtgcgagaccgaggaggacccgcacagcccgcagacgcgcggcatctggaag
gtgctgctcgaaggcgccgaactgtatcgcgcggaggcgaagaacgaagagacgatgcgc
aagtacggccacggcacgccgaacgactggctcgagcgcaatctctactcgaagtatccg
attctcggcgtgagcctgatgatggtgatcgacgtcgcgctgttcggcgtggtcggcctc
accgtgtgggcggtccagatggtgtggattccgttctgggcggcgggcgtcgtcaacggc
ctcggccacttctggggctatcgcaacttcaatgcggccgacgcgagcacgaacctgttc
ccgtggggcatcgtgatcggcggcgaggaactgcacaacaaccatcatacgtttgcgacg
tcggcgaagctgtcgaacaagtggtacgagttcgacatcggctggatgtacatccgcatc
atgtcggcgttcgggctcgcgaaggtgaagaagatcgcgccgacgccgcgcctcgccgcg
cgcaagacggtgctcgaccaggaaacgctgcaggccgtgctgtcgaaccgctacgaggtg
atggcgcgctacgcgaagacgctcaagcgcgcgtacaggcaggagctcgtgcacctgaag
gaactgggcgcgcgcgagaagtatcagctgatgcgcggcgcgcgcaagtggttccacaag
gaagaggcgggcctcgacgagccgcagaagcggatgctgccggagatcttcgcgaacagt
cagaaactgcatacgttcttccagctgcgcacggaactcgccgcgatctgggagcgctcg
aacgcgtcgcgcgaccagttgctcgcgcagctgcaggattggtgccatcgcgccgagcaa
agcggcatcaaggcgctgcaagagttcgcgacgcgtctgcgccgctacgcctga

DBGET integrated database retrieval system