KEGG   Burkholderia thailandensis E264: BTH_I0824Help
Entry
BTH_I0824         CDS       T00311                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bte  Burkholderia thailandensis E264
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bte00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bte00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:bte03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:bte03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bte03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:939082..939498
Genome map
AA seq 138 aa AA seqDB search
MTRIDFHTNVGDSLAYACRLLRKAYQAGQPVVVCAEPARLRALDERLWTFSPLDFIPHCA
VDNAHAASTPIVLTADLERAPHHGILLNLGAQVPAQFARFERLLEVVGNAPDELAAGRDR
YRFYRDRGYALNNHKQGG
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggatcgatttccatacgaacgtcggcgattcgctcgcatacgcgtgccggctg
ctgcgcaaggcgtatcaggcggggcagcccgtcgtcgtgtgcgcggagcccgcgcggctg
cgcgcgctcgacgagcgtttgtggacgttctcgccgctcgatttcattccgcattgcgcg
gtcgacaacgcgcatgcggcgagcacgccgatcgtgctgaccgcggatctcgagcgcgcg
ccgcatcacggaatcctgctgaacctgggcgcgcaggtgccggcgcagttcgcgcgcttc
gagcgcctgctcgaggtggtcggcaacgcgcccgacgagctcgcggccggccgcgaccgg
taccggttctaccgcgaccgtggttacgcgctcaacaatcacaagcagggcggctag

DBGET integrated database retrieval system