KEGG   Burkholderia thailandensis E264: BTH_I0873Help
Entry
BTH_I0873         CDS       T00311                                 

Definition
bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase (EC:4.2.1.75 2.1.1.107)
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bte  Burkholderia thailandensis E264
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BTH_I0873
Enzymes [BR:bte01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BTH_I0873
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BTH_I0873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:996133..998112
Genome map
AA seq 659 aa AA seqDB search
MAGAPRTFTAVLTRPDGQSAALAAQLAAAGIDTLDFPLIDIAPLADDAPLAEAFARLDAY
ALVVFVSPNAIDRALARLGAIWPHPLPIGVVGPGSVAALARHGVAVPAHRVIAPRAPDDG
GEPHYDSESLFAEIARAFDGEAKLAGKRVLIVRGDGGREWLAERLREAGAEVELVAAYRR
VSPEPSIGTWERVHALLSGAPHAWLVTSSEGVRNLQELAHEHLNETEIDALRRAQFVAPH
PRIVETARALGFDRITLSGAGDERIVRTFRTLADQADQPATAAPMPSRMTDTNDTKDVSS
KQAAAPDAPRNQPFTPFETKARRSGSSAALWFVVVVIAAAAGVGGYALNRKVDRLDQHAF
ERQKVLDAQTAELRTKTDQALASVRQADSQLSQLEGKLADAQTAQTALQQQYQDLSRNRD
AWMIEEVGQMLSSASQQLLLTGNTQLALIALQNADSRLASSQSAQAVVVRKAIAQDIERL
KAAPSADLTGLAIKLDDAIAKIDTLPLAGEVLAPHAQAKPDVAASAEQAAAAAGEPRWKA
WWRGFSAGIGAQLKSLVEVRRIDQADAMLASPEQGYFVRENVKLRLLSARLSLLARDDSA
MKSDLHAAQAAVARYFDGASKDTRIVQDLLKQVDAASLTVAVPNLNTSLNAVQQFKSRG
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcgccgcgcacgttcaccgcggtgctcacgcgtcccgacggacagtcggcg
gcgctcgcggcgcaactcgccgcagcgggcatcgacacgctcgactttccgctcatcgac
atcgcgccgcttgccgacgacgcgccgctcgccgaggcgttcgcgcggctcgatgcgtac
gcgctcgtcgtgttcgtgtcgccgaacgcgatcgatcgcgcgctcgcgcggctcggcgcg
atctggccgcatccgctgccgatcggcgtcgtcgggccgggcagcgtcgccgcgctcgcg
cggcacggagtcgccgtgcccgcgcatcgtgtgatcgcgccgcgcgcgcccgacgacggc
ggcgagccgcactacgattccgagagcctgttcgccgagatcgcgcgcgcgttcgacggc
gaggcgaagctcgccggcaagcgcgtgctgatcgtgcgcggcgacggcggacgcgaatgg
ctcgccgagcgcctgcgcgaagcgggcgccgaagtcgagctcgtcgccgcgtatcggcgc
gtgagcccggagccctcgatcggcacgtgggagcgcgtgcacgcgctgctgtcgggcgcg
ccgcacgcgtggctcgtgacgagctcggaaggcgtgcgcaatctgcaggagctcgcgcac
gagcatttgaacgaaaccgagatcgacgcgctcaggcgtgcgcagttcgtcgcgccgcat
ccgaggatcgtcgagaccgcgcgcgcactcggttttgataggattacgctgtccggcgcg
ggcgatgagcgtatcgtccgcacctttcgtacgttggccgatcaggccgatcaaccggcg
acagccgcaccgatgccttctcgcatgacagacaccaacgataccaaagacgtctcttcc
aaacaggctgcggcccccgatgcgccgcggaatcaaccgtttacgccgtttgaaacgaaa
gcgcggcgcagcggctcgagcgcggcgctgtggttcgtggtcgtcgtgatcgcggccgcg
gcgggcgtcggcggctatgcgctgaaccgcaaggtcgaccgcctcgaccagcatgcgttc
gagcgccagaaggtgctcgacgcgcagacggccgagctgcgcacgaagaccgatcaggcg
ctcgcgagcgtgcgtcaggcggattcgcaactgtcgcagctcgaaggcaagctcgccgat
gcgcaaaccgcgcagaccgcgttgcagcagcaatatcaggacctgtcgcgcaaccgcgac
gcatggatgatcgaggaagtcggccagatgctgtcgagcgcgagccagcagctcctcttg
acgggcaacacgcagctcgcgctgatcgcgctgcaaaacgccgattcgcggctcgcttcg
tcgcagagcgcgcaggccgtcgtcgtgcgcaaggcgatcgcacaggacatcgaacgattg
aaggccgcgccgtcggcggacctcaccgggcttgcgatcaagctcgatgacgcaatcgcg
aaaatcgacacgctgccgctcgcgggcgaagtgctcgcgccgcacgcgcaggcgaagccc
gacgttgccgcgagcgccgagcaggcggccgcggcggcgggcgagccgcgctggaaggcg
tggtggcgaggcttttcggcgggcatcggcgcgcaactgaagtcgctcgtcgaagtgcgc
cgcatcgatcaagcggacgcgatgctcgcgtcgcccgagcaaggctacttcgtgcgcgag
aacgtgaagctgcggcttctgagcgcgcggctgtcgctgctcgcgcgcgacgacagcgcg
atgaaatccgatctgcatgccgcgcaggcggccgtcgcgcgctacttcgacggcgcgtcg
aaggacacccggatcgttcaggatctgctcaagcaggtcgacgccgcgtcgctcacggtc
gcggtgccgaacctcaacacgagcctgaacgcggttcaacagttcaagagccggggttga

DBGET integrated database retrieval system