KEGG   Burkholderia thailandensis E264: BTH_I1058Help
Entry
BTH_I1058         CDS       T00311                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bte  Burkholderia thailandensis E264
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:bte01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bte01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bte00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bte00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:bte00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:bte00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:1202063..1202818
Genome map
AA seq 251 aa AA seqDB search
MSKQRIKRVIGNWKMHGRLSGNQALLTEVAQGAQAVHDNVAIGVCVPFPYLAQAQAQLQG
GRVSWGSQDVSAHEQGAYTGEVAAGMVAEFGAAYAIVGHSERRAYHGESNETVAAKARRA
LAAGLTPIVCVGETLAEREAGTTEQVVGAQLDAVLAVLSPDEAARIVVAYEPVWAIGTGK
SATAEQAQQVHAFLRGRLAAKGAGHVSLLYGGSVKADNAAELFGQPDIDGGLIGGASLKS
GDFLAICRAAK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacagagaatcaagcgggtgatcggcaactggaagatgcacggtcgcctgagc
ggcaaccaggcattgctgacggaagtcgcgcagggcgcgcaagcggtacatgacaacgtc
gccatcggcgtgtgcgtgccgttcccatatctcgcgcaggcgcaggctcagcttcagggc
ggtcgcgtctcgtggggctcgcaggacgtgtccgcgcacgagcagggcgcctacaccggc
gaagtcgcggccggcatggtggcggagttcggcgcggcgtacgcgatcgtcgggcactcg
gagcgccgcgcgtatcacggcgaatcgaacgagaccgtcgcggcgaaggcgcggcgcgcg
ctcgctgcggggttgacgcccatcgtgtgcgtcggcgagacgcttgccgagcgcgaagcg
ggcacgaccgagcaggtggtcggcgcgcagctcgatgcggtgctcgcggtgctgtcgccg
gacgaggcggcgcgcatcgtcgtcgcatacgagcccgtatgggccatcggcacgggcaag
agcgcgacggccgagcaggcgcagcaggtgcatgcgttcctgcgcggacggctcgcggcg
aagggcgccgggcacgtgtcgctgttgtatggcggcagcgtgaaggccgacaacgctgcc
gagctgttcggccagccggacatcgacggcggcctgattggcggcgcgtcgttgaagagc
ggggatttcctggcgatctgccgggcagcgaagtaa

DBGET integrated database retrieval system