KEGG   Burkholderia thailandensis E264: BTH_I1058Help
Entry
BTH_I1058         CDS       T00311                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bte  Burkholderia thailandensis E264
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BTH_I1058 (tpiA)
   01230 Biosynthesis of amino acids
    BTH_I1058 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTH_I1058 (tpiA)
   00051 Fructose and mannose metabolism
    BTH_I1058 (tpiA)
   00562 Inositol phosphate metabolism
    BTH_I1058 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BTH_I1058 (tpiA)
Enzymes [BR:bte01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BTH_I1058 (tpiA)
Exosome [BR:bte04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BTH_I1058 (tpiA)
  Exosomal proteins of bladder cancer cells
   BTH_I1058 (tpiA)
  Exosomal proteins of melanoma cells
   BTH_I1058 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:1202063..1202818
Genome map
AA seq 251 aa AA seqDB search
MSKQRIKRVIGNWKMHGRLSGNQALLTEVAQGAQAVHDNVAIGVCVPFPYLAQAQAQLQG
GRVSWGSQDVSAHEQGAYTGEVAAGMVAEFGAAYAIVGHSERRAYHGESNETVAAKARRA
LAAGLTPIVCVGETLAEREAGTTEQVVGAQLDAVLAVLSPDEAARIVVAYEPVWAIGTGK
SATAEQAQQVHAFLRGRLAAKGAGHVSLLYGGSVKADNAAELFGQPDIDGGLIGGASLKS
GDFLAICRAAK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacagagaatcaagcgggtgatcggcaactggaagatgcacggtcgcctgagc
ggcaaccaggcattgctgacggaagtcgcgcagggcgcgcaagcggtacatgacaacgtc
gccatcggcgtgtgcgtgccgttcccatatctcgcgcaggcgcaggctcagcttcagggc
ggtcgcgtctcgtggggctcgcaggacgtgtccgcgcacgagcagggcgcctacaccggc
gaagtcgcggccggcatggtggcggagttcggcgcggcgtacgcgatcgtcgggcactcg
gagcgccgcgcgtatcacggcgaatcgaacgagaccgtcgcggcgaaggcgcggcgcgcg
ctcgctgcggggttgacgcccatcgtgtgcgtcggcgagacgcttgccgagcgcgaagcg
ggcacgaccgagcaggtggtcggcgcgcagctcgatgcggtgctcgcggtgctgtcgccg
gacgaggcggcgcgcatcgtcgtcgcatacgagcccgtatgggccatcggcacgggcaag
agcgcgacggccgagcaggcgcagcaggtgcatgcgttcctgcgcggacggctcgcggcg
aagggcgccgggcacgtgtcgctgttgtatggcggcagcgtgaaggccgacaacgctgcc
gagctgttcggccagccggacatcgacggcggcctgattggcggcgcgtcgttgaagagc
ggggatttcctggcgatctgccgggcagcgaagtaa

DBGET integrated database retrieval system