KEGG   Burkholderia thailandensis E264: BTH_I1190Help
Entry
BTH_I1190         CDS       T00311                                 

Definition
ribonuclease SA
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bte  Burkholderia thailandensis E264
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:1336655..1337086
Genome map
AA seq 143 aa AA seqDB search
MARKWLRNGALASVFAILAMGNIGASPGSLVSAAYAREAAAVNGAAAQVDTVPASRLPRE
AAATLRLIAVGGPYPYEKDGAVFGNYERILPKMRRGYYHEYTVPTPRARNRGARRIVCGG
PLRRVDNCYYTDDHYNSFKRIVD
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaagtggctccgcaacggcgcgctcgcgtccgtcttcgcgatcctcgcgatg
ggcaacatcggcgcttcgccgggcagtctggtttccgccgcatacgcacgggaagccgcc
gcggtcaacggggcggcggcgcaggtcgatacggtccccgcgtcccgtctgccgcgcgag
gcagcggccacgctgcgcctgatcgccgtgggcggcccctatccgtacgagaaagacggc
gcggtattcggcaactacgaacggatcttgccgaagatgcggcgcggctattaccacgag
tacacggtgccgacgccgcgagcccgcaatcgcggcgcgcggcgcatcgtctgtggcggt
cccttgaggcgcgtcgacaattgttattacaccgacgaccactacaacagtttcaaacgt
atcgttgattga

DBGET integrated database retrieval system