KEGG   Burkholderia thailandensis E264: BTH_I1248Help
Entry
BTH_I1248         CDS       T00311                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bte  Burkholderia thailandensis E264
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bte03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(1394184..1394765)
Genome map
AA seq 193 aa AA seqDB search
MIGRIAGTLLEKNPPRILVDCNGVGYEVDVPMSTFYNLPHTGEKVVLLTQLIVREDAHLL
YGFLTPQERSTFRELLKITGVGARMALAVLSGMSVAELSQAVTLQDAARLTRVPGIGKKT
AERLLLELKGKLGADLGPLAGAASPSDHAADILNALLALGYSEKEALAAIKNVPAGTGVS
EGIKLSLKALSKA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcatcgccggcaccctcctcgaaaagaatcctccgcgcatcctcgtcgac
tgcaacggcgtcggctacgaagtcgacgtgccgatgagcacgttctacaacctgcctcac
acgggcgagaaggtcgtgctgctgacccagttgatcgtccgcgaggacgcacacctgctg
tacggctttctcacgccgcaggagcgctcgacgttccgcgagctgctcaagatcacgggc
gtgggtgcgcggatggcgctcgccgtgctgtccggcatgagcgtcgccgaactgtcgcaa
gcggtcaccctgcaggacgccgcgcgcctcacccgcgtgccgggcatcggcaagaagacg
gccgagcgcctgctcctcgaactgaagggcaagctcggcgccgatctcggcccgctcgcc
ggcgcggcctcgccttccgaccacgcggccgacatcctcaacgcgctcctcgcgctcggc
tactcggaaaaggaagcgctggccgcgatcaagaacgtgccggccggcaccggcgtgtcc
gaaggcatcaagctgtcgctcaaagcgctgtcgaaggcgtaa

DBGET integrated database retrieval system