KEGG   Burkholderia thailandensis E264: BTH_I1465Help
Entry
BTH_I1465         CDS       T00311                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bte  Burkholderia thailandensis E264
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bte00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bte00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:1660102..1661133
Genome map
AA seq 343 aa AA seqDB search
MTTDTSGRTGAPAAAAPAERFRYGFLKGNPQLTKNGELKHLLTIEGLPRAILNQILDTAE
QFVSVTDREVKKVPLLRGKSVFNLFFENSTRTRTTFEIAAKRLSADVINLNINASSTSKG
ESLLDTINNLSAMHADLFVVRHASSGAPYLIAEHCAPHVHVINAGDGRHAHPTQGLLDMY
TIRHYKRDFTKLRVAIVGDILHSRVARSDIHALTTLGVPEVRAIGPRTLLPGGLEQMGVR
VFHNLDEGLKDVDVIIMLRLQNERMSGALLPSAQEYFKSWGLTPERLALAAPDAIVMHPG
PMNRGVEIDSQVADGPQSVILNQVTFGIAVRMAVMGIVAGTND
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgacacctccggccgcaccggcgctcccgccgcggccgcgcccgccgagcgc
tttcgctacggcttcctgaagggcaacccgcagctcacgaagaacggcgagctcaagcat
ctgttgacgatcgaagggctgccgcgcgcaatcctcaaccagattctcgacaccgccgag
cagttcgtcagcgtgaccgaccgcgaagtgaagaaggtgccgctcctgcgcggcaaatcg
gtgttcaacctgttcttcgagaattcgacgcgcacgcgcacgacgttcgagatcgccgcg
aagcggctgtccgccgacgtgatcaacctgaacatcaacgcgtcgtcgacgagcaagggc
gagtcgctcctcgacacgatcaacaacctgtcggcgatgcacgccgatctcttcgtcgtg
cgccacgcatcgagcggcgcgccgtacctgatcgccgagcactgcgcgccgcacgtgcac
gtgatcaacgcgggcgacggccgtcatgcgcacccgacgcagggcctcctcgacatgtac
acgattcgccactacaagcgcgacttcacgaagctgcgcgtggcgatcgtcggcgatatt
ctccattcgcgcgtcgcgcgctcggacattcacgcgctgacgacgctcggcgtgcccgag
gtgcgcgcgatcggcccgcgcacgctgctgccgggcgggctcgagcagatgggcgtgcgc
gtgttccacaacctcgacgaaggcctgaaggacgtcgacgtgatcatcatgctgcgtctg
cagaacgagcggatgagcggcgcgctcttgccgtccgcgcaggagtacttcaagagctgg
ggcttgacgcccgagcgtctcgcgctcgccgcgcccgacgcgatcgtgatgcaccccggg
ccgatgaaccgcggcgtcgagatcgattcgcaagtggccgacggcccgcaatcggtgatc
ctgaaccaggtgacgttcggcattgcggtgcgcatggccgtgatggggatcgtcgcgggc
acgaacgactga

DBGET integrated database retrieval system