KEGG   Burkholderia thailandensis E264: BTH_I1489Help
Entry
BTH_I1489         CDS       T00311                                 

Definition
phosphoglucomutase/phosphomannomutase family protein
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bte  Burkholderia thailandensis E264
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTH_I1489
   00030 Pentose phosphate pathway
    BTH_I1489
   00051 Fructose and mannose metabolism
    BTH_I1489
   00052 Galactose metabolism
    BTH_I1489
   00500 Starch and sucrose metabolism
    BTH_I1489
   00520 Amino sugar and nucleotide sugar metabolism
    BTH_I1489
  Nucleotide metabolism
   00230 Purine metabolism
    BTH_I1489
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BTH_I1489
Enzymes [BR:bte01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BTH_I1489
    5.4.2.8  phosphomannomutase
     BTH_I1489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:1687976..1689370
Genome map
AA seq 464 aa AA seqDB search
MISQSIFKAYDIRGVIGKTLDADVARSIGRAFGSEVRAQGGDAVVVARDGRLSGPELVGA
LADGLRAAGVDVVDVGMVPTPVGYFAASVPLALSGGERRVDSCIVVTGSHNPPDYNGFKM
VLRGAAIYGDQIQGLYKRIVDARFETGSGSYEQYDVADQYVERIVGDIKLTRPLKLVVDA
GNGVAGPLATRLFKALGCELVELFTDIDGNFPNHHPDPAHPENLQDVIAKLKATDAEIGF
AFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNPGAQIIYDVKCTRNLARWVREKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILARVADP
SALLNGLPNAVSTPELQLKLEEGENVKLIDKLRADAKFDGADEVVTIDGLRVEYPDGFGL
ARSSNTTPVVVLRFEATSDAALARIQDDFRRALKAAKPGANLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatctcccaatccatcttcaaggcatacgatattcggggcgtgatcggcaagacgctc
gacgccgacgtcgcgcgctcgatcggccgcgcattcggcagcgaagtgcgcgcgcagggc
ggcgacgcggtcgtcgtcgcgcgcgacggccgtctgtcgggccccgaactcgtcggcgcg
ctcgcggacgggctgcgcgcggcgggcgtcgacgtcgtcgacgtcggcatggtgccgacg
ccggtcggctacttcgcggcgagcgtgccgctcgcgctgtcgggcggcgagcgccgcgtc
gactcgtgcatcgtcgtcaccggcagccacaatccgcccgactacaacggcttcaagatg
gtgctgcgcggcgccgcgatctacggcgaccagatccagggcctgtacaagcgcatcgtc
gacgcgcgcttcgagaccggcagcggctcgtacgagcaatacgacgttgccgatcagtac
gtcgagcgcatcgtcggcgacatcaagctcacgcggccgctgaagctcgtcgtcgacgcg
ggcaacggcgtcgcgggcccgctcgcgacgcgcctgttcaaggcgctcggctgcgagctc
gtcgagctgttcaccgacatcgacggcaacttcccgaaccatcacccggacccggcgcac
ccggagaacctgcaggacgtgatcgcgaagctgaaggcgaccgacgccgagatcggcttc
gcgttcgacggcgacggcgatcgcctcggcgtcgtcacgaaggacggccagatcatctat
ccggaccgccagctgatgctgttcgccgaggaagtgctgtcgcgcaatccgggcgcgcaa
atcatctacgacgtgaagtgcacgcgcaatctcgcgcgctgggtgcgcgagaagggcggc
gagccgctgatgtggaagacgggccactcgctcgtgaaggcgaagctgcgcgaaaccggc
gcgccgctcgcgggcgagatgagcggccacgtgttcttcaaggatcgctggtacggcttc
gacgacggtctctacacgggcgcgcgcctgctcgagatcctcgcgcgcgtggcggacccg
agcgcgctcctgaacggcctgccgaacgcggtgtcgacgcccgagcttcagctcaagctc
gaagagggcgagaacgtgaagctgatcgacaagctgcgcgccgacgcgaagttcgacggc
gcggacgaagtcgtgacgatcgacggcctgcgcgtcgagtatccggacggcttcggcctc
gcgcgctcgtcgaacacgacgcccgtagtcgtgctgcgcttcgaggcgacgtccgacgcg
gcgctcgcgcgaatccaggacgatttccggcgcgcgctgaaggcggcgaagccgggcgcg
aacctgccgttctga

DBGET integrated database retrieval system