KEGG   Burkholderia thailandensis E264: BTH_I1507Help
Entry
BTH_I1507         CDS       T00311                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bte  Burkholderia thailandensis E264
Brite
Enzymes [BR:bte01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BTH_I1507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1706647..1707300)
Genome map
AA seq 217 aa AA seqDB search
MNIEKARFNMIEQQIRPWDVLDQDVLSLLSVVKRENFVPAAYRDLAFADVELPLPNGQKM
LFPRVEARVLQELAVKKHENVLEIGAGSGYMAALLAARGQRVTTVEIDPDLAKFAEENLK
KNGVTNAEVVLGDGSRGWPAKAPYDVICVSGGLPVVPQELLEQLKVGGRLAAFVGGRPVM
KAQIITRIDDKQYRVADVFETYVDHLVNAMEPSRFKF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgaaaaagcacgtttcaacatgatcgaacagcagatccggccttgggatgta
ctggatcaggacgtcttgagcctgctgtcggtcgtcaagcgtgagaacttcgtgccggcc
gcgtatcgcgacctggcgttcgccgacgtcgagctgccgctgccgaatggccagaagatg
ctgttcccgcgcgtcgaggcgcgcgtcctgcaggagctcgcggtgaagaagcacgagaac
gtgctcgagatcggcgcgggctccggctacatggcggcgctgctggccgcgcgcggccag
cgcgtgacgacggtcgagatcgatccggacctcgcgaagttcgccgaggagaacctgaag
aagaacggcgtgacgaacgccgaggtcgtgctcggcgacggttcgcgcggctggcccgcg
aaggcgccgtacgacgtgatctgcgtgtcgggcggcctgcccgtcgtcccgcaggagctg
ctcgagcaactgaaggtgggcggccgcctcgcggcgttcgtcggcggccggccggtgatg
aaggcgcagatcatcacgcgcatcgacgacaagcagtatcgcgtcgccgacgtgttcgaa
acctacgttgaccacctcgtcaacgcgatggagccgtcgcgcttcaagttctga

DBGET integrated database retrieval system