KEGG   Burkholderia thailandensis E264: BTH_I1550Help
Entry
BTH_I1550         CDS       T00311                                 

Definition
(GenBank) glucokinase/transcriptional regulator, RpiR family, fusion
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00010  Glycolysis / Gluconeogenesis
bte00052  Galactose metabolism
bte00500  Starch and sucrose metabolism
bte00520  Amino sugar and nucleotide sugar metabolism
bte00521  Streptomycin biosynthesis
bte01100  Metabolic pathways
bte01110  Biosynthesis of secondary metabolites
bte01120  Microbial metabolism in diverse environments
bte01130  Biosynthesis of antibiotics
bte01200  Carbon metabolism
Module
bte_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTH_I1550
   00052 Galactose metabolism
    BTH_I1550
   00500 Starch and sucrose metabolism
    BTH_I1550
   00520 Amino sugar and nucleotide sugar metabolism
    BTH_I1550
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BTH_I1550
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BTH_I1550
Enzymes [BR:bte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BTH_I1550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase HTH_6 SIS SIS_2 ROK LacI HTH_IclR
Motif
Other DBs
NCBI-ProteinID: ABC37839
UniProt: Q2SYA5
Position
I:complement(1749745..1751670)
Genome map
AA seq 641 aa AA seqDB search
MSTGAQTKAAEASQHADGPRLLADVGGTNARFALETGPGEITQIRVYPGAEYPTLTDAIR
RYLKDVKIGRVNHAAIAIANPVDGDQVRMTNHNWSFSIEATRRALGFDTLLVVNDFTALA
MALPGLTDAQRVQIGAGARRQNSVIGLMGPGTGLGVSGLIPADDRWIALGSEGGHATFAP
MDEREDLVLQYARRKYPHVSFERVCAGPGMEIIYRALAARDKKRIAANVVTADIVERAHA
GDALALEAVECFCGILGTFAGNLAVTLGALGGIYIGGGVVPKLGELFMRSPFRARFEAKG
RFEAYLANIPTYLITAEYPAFLGVSAILAEQLSNRTGGASSAVFERIRQMRDALTPAERR
VADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPM
SHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVEQAIDILNNARRIEFYGLGNSN
IVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQ
AGAKVIAITSSNTPLAKRATVALETDHIEMRESQLSMISRILHLVMIDILAVGVAIRRAS
PNAELAEAMARAKARAGASAGDEAADVLDWLSHGAAPAAKE
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtgcgcaaactaaggccgccgaggcgagccagcacgcggacgggccgcgc
ctattggccgacgtcggcggcacgaacgcgcgcttcgcgctcgagacggggcctggcgag
atcacgcagatccgcgtgtaccccggcgccgagtatccgacgctcaccgacgcgatccgc
aggtatctgaaagacgtgaagatcggccgcgtgaatcacgcggcgatcgcgatcgcgaac
cccgtcgacggcgatcaggtccggatgacgaatcacaactggagcttctcgatcgaggcg
acgcgccgcgcgctcggcttcgacacgctgctcgtcgtcaacgatttcaccgcgctcgcg
atggcgctgcccggcctgaccgacgcgcagcgcgtgcagatcggcgccggcgcgcgcagg
caaaacagcgtgatcggcctgatggggccgggcacggggctcggcgtgtcgggcctcatc
cccgccgacgaccgctggatcgcgctcggcagcgaaggcggccacgcgacgttcgcgccg
atggacgagcgcgaggatctcgtgctgcagtacgcgcgccgcaagtatccgcacgtgtcg
ttcgagcgcgtgtgcgcgggcccgggcatggagatcatctaccgcgcgctcgccgcgcgc
gacaagaaacgcatcgccgcgaacgtcgtcacggccgacatcgtcgagcgcgcgcacgcg
ggcgatgcgctcgcgctcgaggcggtcgagtgcttctgcggaattctcggcacgttcgcg
ggcaacctcgcggtgacgctcggcgcattgggcggcatctatatcggcggcggcgtcgtg
ccgaagctgggcgagctcttcatgcgctcgccgtttcgcgcgcgcttcgaggcgaagggc
cgcttcgaggcgtatctcgcgaacatcccgacctacctgatcaccgccgaatatccggcg
ttcctcggcgtgtcggcgatcctcgccgagcagttgtcgaaccgcacgggcggcgcgtcg
tcggccgtgttcgagcgcatccgccagatgcgcgacgcgttgacgcccgccgagcggcgc
gtcgccgatctcgcgctcaaccacccgcgctcgatcatcaacgatccgatcgtcgacatc
gcgcgcaaggccgacgtgagccagccgaccgtgatccgcttctgccgctcgctcggctgc
caggggctgtcggacttcaagctgaagctcgccacaggcttgacgggcacgatcccgatg
agccacagccaggtgcatctcggcgatacggccaccgatttcggcgcgaaggtgctcgac
aacaccgtgtcggcgatccttcagttgcgcgagcacctgaacttcgagcacgtcgagcag
gcgatcgacatcctgaacaacgcgcggcgcatcgagttctatgggctcggcaattcgaac
atcgtcgcgcaggacgcgcattacaagttcttccgcttcgggattccgacgatcgcgtac
ggcgacctgtacatgcaggccgcgtcggccgcgctcctcggcaagggcgacgtgatcgtc
gcggtgtcgaagtccggacgcgcgccggagctgctgcgcgtgctcgacgtcgcgatgcag
gcgggcgcgaaggtgatcgcgatcacgtcgagcaacacgccgctcgccaagcgcgcgacg
gtggcgctcgagaccgaccacatcgagatgcgcgagtcgcagttgtcgatgatctcgcga
atcctgcatctcgtgatgatcgacatcctcgcggtcggcgtcgcgatccgccgcgcctcg
ccgaacgcggagctcgcggaggcgatggcgcgcgcgaaagcgcgcgcgggtgcgagcgcg
ggcgacgaagccgcggacgtgctcgactggctgagccacggcgcggcgcccgcggcgaag
gagtga

DBGET integrated database retrieval system