KEGG   Burkholderia thailandensis E264: BTH_I1735Help
Entry
BTH_I1735         CDS       T00311                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bte  Burkholderia thailandensis E264
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bte00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bte00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:1943186..1944214
Genome map
AA seq 342 aa AA seqDB search
MKLPPGPVMLDVVGTTLTRDDARRLAHPQTGGVILFARHFESRAQLVALTDAIRAIRDDI
LIAVDHEGGRVQRFRTDGFTVLPAMRRLGELWDKDVLHATKAATATGYVLASELRACGID
MSFTPVLDLDYGRSKVIGDRALHRDPRVVALLAKSLNHGLALAGMSNCGKHFPGHGFAEA
DSHVALPIDDRPLDEILANDAAPYDWLGLSLSAVIPAHVIYTQVDSKPAGFSRVWLQDVL
RGRLRFPGAVFSDDLSMEAAREGGTLAQAAQAALDAGCDMVLVCNQPDAAQRVLDELRTT
TSHESLLRIKQMRPRGKALKWRKLMREPRYLSAQELLRSTFA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccccccggtccggtgatgctcgacgtcgtcggcacgacgctcacgcgtgac
gacgcgcgccgtctcgcgcatccacagacgggcggcgtgattctgttcgcgcgccacttc
gaaagccgcgcgcagctcgtcgcgctgaccgacgcgatccgggcgatccgcgacgacatc
ctgatcgcggtcgatcacgagggcggccgggtgcagcgctttcgcaccgacggcttcacc
gtgctgccggcgatgcgccggctcggcgagctgtgggacaaggatgtgctgcacgcgacg
aaggcggcgaccgcgacgggctacgtgctcgcgtccgagctgcgcgcgtgcggcatcgac
atgagtttcacgcccgtgctcgacctcgactacggccgctcgaaggtgatcggcgatcgc
gcgctccatcgcgatccgcgcgtcgtcgcgctgcttgcgaagagtctgaatcacgggctt
gcgcttgccgggatgtcgaactgcggcaagcattttcccggtcatggcttcgctgaggcc
gattcgcacgtcgcgctgccgatcgacgatcgcccgctcgacgagatcctcgcgaacgat
gcggcgccgtacgactggctcgggctgtcgctgtcggccgtcattccggcgcacgtgatt
tacacgcaggtcgattcgaagccggcgggcttctcgcgcgtatggctgcaggacgtgctg
cgcggccggctgcgtttcccgggcgcggtgttcagcgacgatctgtcgatggaagccgcg
cgcgaaggcggcacgctcgcgcaggcggcgcaggccgcgctcgatgcgggctgcgacatg
gtgcttgtgtgcaatcaaccggatgcggcgcagcgggtgctcgacgagctgcgcacgacg
acgtcgcacgaatcgctgctgcggatcaagcagatgcgcccgcgcggcaaggcgctcaaa
tggcgcaagctgatgcgtgagccgcgctatctgagcgcgcaggaactgttgcgcagcacg
ttcgcttga

DBGET integrated database retrieval system