KEGG   Burkholderia thailandensis E264: BTH_I1745Help
Entry
BTH_I1745         CDS       T00311                                 

Definition
GAF domain-containing protein
Orthology
K07170  
GAF domain-containing protein
Organism
bte  Burkholderia thailandensis E264
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(1953635..1954147)
Genome map
AA seq 170 aa AA seqDB search
MFALSEALPSSKPALYETLAAQARALVETETDIVANAANFASLVYHSLDGLNWAGFYFFD
GRELVVGPFQGKPACVRIPLGKGVCGTAAQTRGTQVVHDVHAFAGHIACDSASRSEIVVP
LIARDGALIGVWDVDSPLIGRFDAEDATGMEALCRVFVEVAWENATRRGE
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcgctctccgaagcccttccatcgtcgaagcccgcgctctacgaaacgctcgcc
gcgcaggcgcgcgcgctcgtcgagacggaaaccgacatcgtcgccaacgctgcgaatttc
gcatcgctcgtctatcactcgctcgatggcctcaactgggccggcttctatttcttcgac
ggccgcgagctcgtcgtcgggccgttccagggcaagcccgcatgcgtgcgcatcccgctt
ggcaagggcgtgtgcggcactgccgcgcagacgcgcggcacgcaggtcgtgcacgacgtg
cacgcgttcgccggccacatcgcctgcgattcggcgtcgcgatcggaaatcgtcgtgccg
ctcatcgcgcgcgacggcgcgttgatcggcgtatgggatgtcgacagcccgctgatcggc
cgcttcgacgcggaggatgcgacaggaatggaggcgctgtgccgagtgttcgtcgaggtt
gcgtgggagaacgcgacgcggcgcggcgagtaa

DBGET integrated database retrieval system