KEGG   Burkholderia thailandensis E264: BTH_I1745Help
Entry
BTH_I1745         CDS       T00311                                 

Definition
(GenBank) GAF domain protein
  KO
K08968  
L-methionine (R)-S-oxide reductase [EC:1.8.4.14]
Organism
bte  Burkholderia thailandensis E264
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BTH_I1745
Enzymes [BR:bte01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.14  L-methionine (R)-S-oxide reductase
     BTH_I1745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(1953635..1954147)
Genome map
AA seq 170 aa AA seqDB search
MFALSEALPSSKPALYETLAAQARALVETETDIVANAANFASLVYHSLDGLNWAGFYFFD
GRELVVGPFQGKPACVRIPLGKGVCGTAAQTRGTQVVHDVHAFAGHIACDSASRSEIVVP
LIARDGALIGVWDVDSPLIGRFDAEDATGMEALCRVFVEVAWENATRRGE
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcgctctccgaagcccttccatcgtcgaagcccgcgctctacgaaacgctcgcc
gcgcaggcgcgcgcgctcgtcgagacggaaaccgacatcgtcgccaacgctgcgaatttc
gcatcgctcgtctatcactcgctcgatggcctcaactgggccggcttctatttcttcgac
ggccgcgagctcgtcgtcgggccgttccagggcaagcccgcatgcgtgcgcatcccgctt
ggcaagggcgtgtgcggcactgccgcgcagacgcgcggcacgcaggtcgtgcacgacgtg
cacgcgttcgccggccacatcgcctgcgattcggcgtcgcgatcggaaatcgtcgtgccg
ctcatcgcgcgcgacggcgcgttgatcggcgtatgggatgtcgacagcccgctgatcggc
cgcttcgacgcggaggatgcgacaggaatggaggcgctgtgccgagtgttcgtcgaggtt
gcgtgggagaacgcgacgcggcgcggcgagtaa

DBGET integrated database retrieval system