KEGG   Burkholderia thailandensis E264: BTH_I1865Help
Entry
BTH_I1865         CDS       T00311                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00010  Glycolysis / Gluconeogenesis
bte00020  Citrate cycle (TCA cycle)
bte00620  Pyruvate metabolism
bte01100  Metabolic pathways
bte01110  Biosynthesis of secondary metabolites
bte01120  Microbial metabolism in diverse environments
bte01130  Biosynthesis of antibiotics
bte01200  Carbon metabolism
Module
bte_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTH_I1865 (aceF)
   00020 Citrate cycle (TCA cycle)
    BTH_I1865 (aceF)
   00620 Pyruvate metabolism
    BTH_I1865 (aceF)
Enzymes [BR:bte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BTH_I1865 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N NQRA HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ABC38586
UniProt: Q2SXF4
Position
I:2109378..2111024
Genome map
AA seq 548 aa AA seqDB search
MSQAIEVKVPDIGDYKDVPVIEVLVKPGDAVEPEQSLVTLESDKATMDVPSPSAGTVKEV
KVKVGDAVSQGSLIVLLDGAQAAGRPAQANGAAASAAQPAAAPVAAAPAPVAAGGGTVDV
RVPDIGDYKDVPVIEIAVKIGDTVEKEQSLVTLESDKATMDVPSPAAGVVKDIKVKVGDA
VSEGSLIVVLEASGAAAASAPQAAAPAQAAPAPAAAPAPAPQAAPAPQAAPAAAPAPAAS
GEYRPSHASPSVRKFARELGVDVSRVAGTGPKNRITKDDVTAFVKGVMTGQRAAPAAAAP
AGGGELNLLPWPKVDFSKFGPFEAKPLSRIKKISGANLHRNWVMIPHVTNNDEADITDLE
ALRVQLNKEHEKAGVKFTMLAFVIKAVVAALKKFPTFNASLDGDNLVFKQYYHIGFAADT
PNGLVVPVIRDADKKGLVEIAKEMAELSKAAREGKLKPDQMQGGCFSISSLGGIGGTHFT
PIINAPEVAILGLSRGQMKPVWDGKQFVPRLTLPLSLSYDHRVIDGAEAARFNAYLGALL
GDFRRIIL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtcaaggtgccggatatcggcgattacaaggacgtgcccgtc
atcgaggtgctcgtgaagccgggcgatgcggtcgagcccgagcagtcgctcgtcacgctc
gagtccgacaaggcgacgatggacgtgccgagcccgtcggcgggcacggtgaaggaagtg
aaggtgaaggtcggcgacgcggtgtcgcaaggttcgctgatcgtgctgctcgacggcgcg
caggcggcgggcaggcccgcgcaggcgaacggcgccgcggcgagcgccgctcagccggcg
gccgcgcccgttgccgccgcgcctgcgcctgtggcggcgggcggcggcacggtcgacgtg
agggtgccggacatcggcgactacaaggacgtgcccgtcatcgagatcgccgtgaagatc
ggcgacacggtcgagaaggagcagtcgctcgtcacgctcgagtccgacaaggcgacgatg
gacgtgccgagcccggccgcgggcgtcgtcaaggacatcaaggtgaaggtgggcgacgcg
gtgtcggaaggctcgctgatcgtcgtgctcgaggcgtcgggcgccgccgccgcgagcgcg
ccgcaggccgccgcgcccgctcaggccgcgcccgctcccgcggctgcaccggcacccgcg
cctcaggctgcacccgcgccgcaggcggcgcccgcagccgcgcctgcgcccgccgcgagc
ggcgagtaccgcccgagccacgcgtcgccgtcggtgcgcaagttcgcgcgcgaactcggt
gtcgacgtgtcgcgcgtcgcgggcacggggccgaagaaccgcatcacgaaggacgacgtc
accgcgttcgtgaagggcgtgatgacggggcagagggcggcgcccgccgcggcggcgccg
gcaggcggcggcgagctgaatctgctgccgtggccgaaggtcgatttctcgaagttcggc
ccgttcgaggcgaagccgctgtcgcggatcaagaagatctcgggcgcgaacctgcatcgc
aactgggtgatgatcccgcacgtcacgaacaacgacgaagcggacatcaccgatctcgag
gcgctgcgcgtgcaactgaacaaagagcacgagaaggcgggcgtgaagttcacgatgctc
gcgttcgtgatcaaggcggtggtggcggcgctcaagaaattcccgaccttcaacgcgagc
ctcgacggcgacaacctcgtcttcaagcagtactaccacattggtttcgcggccgacacg
ccgaacggcctcgtcgtgccggtgatccgcgatgcggacaagaaggggctcgtcgagatc
gcgaaggaaatggccgagttgtcgaaggccgcgcgcgaaggcaagctgaagccggaccag
atgcagggcggctgcttctcgatctcgtcgctcggcgggatcggcggcacgcacttcacg
ccgatcatcaacgcgccggaagtggcgatcctcgggttgtcgcgcggccagatgaagccg
gtgtgggacggcaagcagttcgtgccgcgcctcacgctgccgctgtcgctgtcgtatgac
catcgcgtgatcgacggcgcggaagccgcgcggttcaatgcgtatctcggggcgttgctc
ggggatttccgccgcatcattctttga

DBGET integrated database retrieval system