KEGG   Burkholderia thailandensis E264: BTH_I1920Help
Entry
BTH_I1920         CDS       T00311                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bte  Burkholderia thailandensis E264
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:2167315..2167812
Genome map
AA seq 165 aa AA seqDB search
MAKLPKKTLAGVVGAIAAGVLTVIVPKFEGVKLAGYLDPVGIPTKCMGDTRDVIVGRTYS
EAECRQSLETQLIAHAEPVLRCTPGLKDRPYQLAAAVSFAYNVGANAYCASTTARRFNAG
DLRGACRAINEADDGRPQWVTARGRVLPGLVKRRAEERAICERGL
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggctaagttgccgaagaagacgctcgccggcgtcgtcggcgcgatcgcggccggtgtg
ctgacggtgatcgtgccgaagttcgagggcgtcaagctggcgggctacctcgatccggtc
ggcattccgacgaagtgcatgggcgacacgcgcgacgtcatcgttggcaggacatacagc
gaggccgagtgtcgccagtcgctcgaaacgcaattgatcgcgcacgctgaacccgtgctg
cgttgcacgccggggctgaaagatcgtccgtatcagctcgcggcggccgtcagctttgca
tacaacgtcggcgcgaacgcctactgcgccagcacgacggcgaggcgcttcaacgcgggc
gacctgcgcggcgcgtgccgcgcgatcaacgaagccgacgacggccgcccgcaatgggta
acggcgcggggccgggtgttgcccggtttggtgaagcggcgggcggaagagcgcgcgatt
tgcgagcgggggctgtga

DBGET integrated database retrieval system