KEGG   Burkholderia thailandensis E264: BTH_I1994Help
Entry
BTH_I1994         CDS       T00311                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00620  Pyruvate metabolism
bte00630  Glyoxylate and dicarboxylate metabolism
bte01100  Metabolic pathways
bte01110  Biosynthesis of secondary metabolites
bte01120  Microbial metabolism in diverse environments
bte01200  Carbon metabolism
Module
bte_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTH_I1994 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    BTH_I1994 (aceB)
Enzymes [BR:bte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     BTH_I1994 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABC37869
UniProt: Q2SX31
Position
I:complement(2257090..2258682)
Genome map
AA seq 530 aa AA seqDB search
MTTTLKLPQGMAITGEIKPGYEAILTPEALELVATLHRQFEPRRRELLAARVERTKHLDA
GERPDFLAETKSIREGDWKVAPLPADLQCRRVEITGPVERKMIINALNSGADSYMTDFED
SNAPSWTNQIDGQINLKDAVRRTISLEQNGKSYKLNDKIATLIVRPRGWHLDEKHVTVDG
QRVSGGVFDFALFLFHNAKELIARGSGPYFYLPKMESHLEARLWNDIFVAAQAAVGIPRG
TIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDRDFCLADRAKI
TMTVPFMRAYALLLLKTCHKRNAPAIGGMSALIPIKNDPEANEKAMAGVRADKNRDATDG
YDGGWVAHPGLVSLAMEEFVKVLGDKPNQIGKQRDDVQIEGKNLLDFQPEAPITEAGLRN
NINVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGTLDDGRKVTAELV
REYAKAELGKVKQVVGGDTAPYDRAAVIFEQMSTSENFTEFLTLPLYEEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgacgctgaagctgccgcaaggcatggcgatcacgggcgagatcaagcccggc
tacgaagcgatcctcacgcccgaggcgctcgaactcgtcgcgacgctgcatcgccagttc
gagccgcgccgccgcgagctgctcgccgcgcgcgtcgagcgcaccaagcacctcgacgcc
ggcgagcgccccgacttcctcgccgagacgaaatcgatccgcgaaggcgactggaaggtg
gcgccgctgcccgcggatctgcagtgccgccgcgtcgagatcacgggccccgtcgagcgc
aagatgatcatcaacgcgctgaactcgggcgcggactcgtacatgacggacttcgaggac
tcgaacgcgccgagctggaccaaccagatcgacggccagatcaacctgaaggacgcggtg
cgccgcacgatctcgctcgagcagaacggcaagtcgtacaagctcaacgacaagatcgcg
acgctgatcgtgcgcccgcgcggctggcacctcgacgaaaagcacgtgacggtggacggc
cagcgcgtgtcgggcggcgtcttcgatttcgccctcttcctgttccacaacgcgaaggag
ctgatcgcgcgcggctccggcccgtacttctacctgccgaagatggaaagccatctcgag
gcgcgcctctggaacgacatcttcgtcgccgcgcaggcagcggtcggcattccgcgcggc
acgatccgcgcgaccgtgctgatcgagacgatcctcgccgcgttcgagatggacgagatc
ctctatgagcttcgcgagcacagctctggcctgaacgcgggccgctgggactacatcttc
tcggcgatcaagaagttcaagaacgaccgcgacttctgcctcgccgaccgcgcgaagatc
acgatgacggtgccgttcatgcgcgcgtatgcgctgttgctgctgaagacctgccacaag
cgcaacgcgccggcgatcggcgggatgagcgcgctgatcccgatcaagaacgatccggag
gcgaacgagaaggcgatggccggcgtgcgcgcggacaagaaccgcgatgcgaccgacggc
tacgacggcggctgggtcgcgcacccgggcctcgtgtcgctcgcgatggaagagttcgtc
aaggtgctcggcgacaagccgaaccagatcggcaagcagcgcgacgacgtgcagatcgag
ggcaagaacctgctcgatttccagccggaagcgccgatcaccgaagcgggcctgcgcaac
aacatcaacgtcggcattcactacctcggctcgtggctcgcgggcaacggctgcgtgccg
atccacaatctgatggaagacgcggcgacggccgaaatctcgcgctcgcaggtctggcag
tggatccgctcgccgaagggcacgctcgacgacggccgcaaggtgacggccgagctcgtg
cgcgaatacgcgaaggcggagctcgggaaggtgaagcaggtcgtcggcggcgacacggcg
ccgtacgaccgtgccgcggtcatcttcgagcagatgtcgacgtcggagaacttcaccgag
ttcctgacgctgccgctttacgaggagatctaa

DBGET integrated database retrieval system