KEGG   Burkholderia thailandensis E264: BTH_I2130Help
Entry
BTH_I2130         CDS       T00311                                 

Definition
acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bte  Burkholderia thailandensis E264
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BTH_I2130
Enzymes [BR:bte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BTH_I2130
   3.1.2  Thioester hydrolases
    3.1.2.-  
     BTH_I2130
Lipid biosynthesis proteins [BR:bte01004]
 Fatty acid synthase
  Component type
   BTH_I2130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2403757..2404455)
Genome map
AA seq 232 aa AA seqDB search
MIGSVILSMKRTFHWKVGATLAVIAALADPASAATNAAPAANANGGKPVIVVLGDSLSAE
YGLPRDTGWVALMRARLAAERIDYSVANASISGDTTSGGRARLPAVLARLKPAVVVVELG
ANDALRGVPLAATESNLREIVAKARRARAQVLLVGMYVPANYGPDYTQKFHGVYTTLSKE
MRVPLVPFLLAGIENKPDMFQTDQIHPTQAAQRQLLDNVWPTLKPLLRTSSH
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgatcggatcggtaatcttgagcatgaaacgcacatttcactggaaggtcggcgcaacg
ctcgccgtgatcgcggcgctcgccgatccggcatccgccgcaacgaatgccgcgcccgcg
gcgaacgccaacggcggcaagccggtgatcgtcgtgctcggcgacagcctgtcggccgaa
tacggcctgccgcgcgacacgggatgggtcgcgctgatgcgcgcgcgcctcgcggccgag
cgaatcgattatagcgtcgcgaacgcgagcatctccggcgacacgacgagcggcggccgc
gcacggctgcctgcggtgctcgcgcggctcaagcccgccgtcgtcgtcgtcgagctcggc
gcgaacgacgcgctgcgcggcgtgccgctcgccgcgaccgaaagcaacctgcgcgagatc
gtcgcgaaggcgcggcgcgcgcgcgcgcaggtgctgctcgtcggcatgtacgtgccggcg
aactacggaccggactacacgcagaaatttcacggcgtctacacgacgctgtccaaggag
atgcgcgtgccgctcgtgccgttcctgctcgccggcatcgagaacaagcccgacatgttc
cagaccgaccagatccatccgacgcaggccgcacagcgccagttgctcgacaacgtgtgg
ccgaccctcaagccgctgttgcggacgtcgtcgcactga

DBGET integrated database retrieval system