KEGG   Burkholderia thailandensis E264: BTH_I2143Help
Entry
BTH_I2143         CDS       T00311                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bte  Burkholderia thailandensis E264
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BTH_I2143
Enzymes [BR:bte01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BTH_I2143
    3.5.1.-  
     BTH_I2143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:2422601..2423239
Genome map
AA seq 212 aa AA seqDB search
MQRTDDVLLVIDVQNDFMPGGALAVAHGDEIVPVINRLAARFDHVVLTQDWHPRDHVSFA
ANHPGRAPFSTVELPYGEQVLWPVHCVQGTQGAALHGDLDIPHARLVIRKGHDASVDSYS
AFVEADRTTPTGLAGYLRELGAKRVWCCGLATDYCVAWSALDARAAGFGAAVIEDACRAI
DLDGSLARAWASLAAAGVARVRSADAHPGVDP
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcaccgacgatgtccttctcgtgatcgacgtgcagaacgatttcatgccgggc
ggcgcgctcgcggttgcgcacggcgacgaaatcgtgccggtgatcaaccggctcgccgcg
cgcttcgatcacgtcgtgctgacgcaggactggcatccgcgcgatcacgtgtcgttcgcg
gcgaaccatccgggccgcgcgccgttctcgaccgtcgagctgccgtacggcgagcaggtg
ctgtggcccgtgcattgcgtgcagggcacgcaaggcgcggcgctgcacggcgatctcgac
attccgcacgcgcggctcgtgatccgcaagggtcatgacgcgtcggtcgacagctactcg
gcgttcgtcgaagccgatcgcacgacgccgacggggcttgccggctatctgcgcgagctc
ggcgcgaagcgcgtgtggtgctgcgggctcgcgacggactattgcgtcgcgtggtccgcg
ctcgacgcgcgcgccgcgggcttcggcgccgccgtgatcgaggacgcgtgccgcgcgatc
gatctcgacggctcgctcgcgcgcgcatgggcgtcgctcgcggcggcgggcgtcgcgcgc
gtgcggtcggccgacgcccatcccggcgtcgatccgtga

DBGET integrated database retrieval system