KEGG   Burkholderia thailandensis E264: BTH_I2199Help
Entry
BTH_I2199         CDS       T00311                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bte  Burkholderia thailandensis E264
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BTH_I2199 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BTH_I2199 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BTH_I2199 (thrC)
Enzymes [BR:bte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BTH_I2199 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:2474297..2475748
Genome map
AA seq 483 aa AA seqDB search
MNYISTRGAGIGERHTFSDILLGGLAKDGGLYLPSEYPQVSADELARWRTLPYADLAFEI
LSKFCDDIAAADLRAITRRTYTADVYRHARRGGNAADITPLTTLGTENGAPVSLLELSNG
PTLAFKDMAMQLLGNLFEYTLAKHGETLNILGATSGDTGSAAEYAMRGKEGVRVFMLSPH
KKMSAFQTAQMYSLQDPNIFNLAVNGVFDDCQDIVKAVSNDHAFKAQQKIGTVNSINWAR
VVAQVVYYFKGYFAATRSNDERVSFTVPSGNFGNVCAGHIARMMGLPIEKLVVATNENDV
LDEFFRTGAYRVRSAQDTYHTSSPSMDISKASNFERFVFDLLGRDPARVVQLFRDVEQKG
GFDLAASGDFARVAEFGFVSGRSTHADRIATIRDVFERYRTMIDTHTADGLKVAREHLRP
GVPMVVLETAQPIKFGESIREALGQEPSRPAAFDGLEALPQRFEVVDANAQQVKDFIAAH
TGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaattacatctccacgcgcggcgccggcatcggcgagcgccatacgttctccgacatc
ctgctcggcggcctcgcgaaggacggcgggctctatctgccgagcgagtatccgcaggtg
agcgcggacgagctcgcgcgctggcgcacgctgccgtacgcggatctcgcgttcgagatc
ctgtcgaagttctgcgacgacatcgccgccgccgacctgcgcgcgatcacgcgccgcacg
tacacggccgacgtgtaccgccacgcgcgccgcggcgggaacgcggccgacatcacgccg
ctcacgacgctcggcaccgagaacggcgcgcccgtctcgctgctcgagctgtcgaacggc
ccgacgctcgcgttcaaggacatggcgatgcagttgctcggcaatctgttcgagtacacg
ctcgccaagcacggcgaaacgctgaacatcctcggcgcgacgtcgggcgacacgggcagc
gcggccgaatacgcgatgcgcggcaaagagggcgtgcgcgtgttcatgctgtcgccgcac
aagaagatgagcgcgttccagaccgcgcagatgtacagcctgcaggacccgaacatcttc
aacctcgcggtgaacggcgtgttcgacgactgccaggacatcgtgaaggccgtgtcgaac
gatcacgcgttcaaggcgcagcagaagatcggcaccgtcaattcgatcaactgggcgcgc
gtcgtcgcgcaggtcgtctactacttcaagggctacttcgcggcgacgcggtcgaatgac
gagcgcgtgtcgttcacggtgccgtcgggcaatttcggcaacgtctgcgcgggccacatc
gcgcgcatgatggggctgccgatcgagaagctcgtcgtcgcgacgaacgagaacgacgtg
ctcgacgagtttttccgcacgggcgcgtaccgcgtgcgcagcgcccaggacacgtatcac
acgagcagcccgagcatggacatctcgaaggcgtcgaacttcgagcgcttcgtgttcgat
ctgctcggccgcgatccggcgcgtgtcgtccagctgtttcgcgatgtcgagcaaaagggc
ggcttcgatctcgcggcgagcggcgatttcgcgcgcgtcgccgagttcggcttcgtgtcg
ggccgcagcacgcacgcggaccggatcgcgacgatccgcgacgtgttcgagcgctaccgc
acgatgatcgacacgcatacggccgacggcctgaaggtcgcgcgcgagcatctgcggccg
ggcgtgccgatggtcgtgctcgagaccgcgcagccgatcaagttcggcgaatcgattcgc
gaggcgctcgggcaggagccgtcgcggcctgccgcgttcgacgggctcgaggcgctgccg
cagcgcttcgaggtcgtcgacgcgaacgcgcagcaagtgaaggacttcatcgccgcgcat
acgggcgcgtga

DBGET integrated database retrieval system