KEGG   Burkholderia thailandensis E264: BTH_I2199Help
Entry
BTH_I2199         CDS       T00311                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bte  Burkholderia thailandensis E264
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BTH_I2199 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BTH_I2199 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BTH_I2199 (thrC)
Enzymes [BR:bte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BTH_I2199 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:2474297..2475748
Genome map
AA seq 483 aa AA seqDB search
MNYISTRGAGIGERHTFSDILLGGLAKDGGLYLPSEYPQVSADELARWRTLPYADLAFEI
LSKFCDDIAAADLRAITRRTYTADVYRHARRGGNAADITPLTTLGTENGAPVSLLELSNG
PTLAFKDMAMQLLGNLFEYTLAKHGETLNILGATSGDTGSAAEYAMRGKEGVRVFMLSPH
KKMSAFQTAQMYSLQDPNIFNLAVNGVFDDCQDIVKAVSNDHAFKAQQKIGTVNSINWAR
VVAQVVYYFKGYFAATRSNDERVSFTVPSGNFGNVCAGHIARMMGLPIEKLVVATNENDV
LDEFFRTGAYRVRSAQDTYHTSSPSMDISKASNFERFVFDLLGRDPARVVQLFRDVEQKG
GFDLAASGDFARVAEFGFVSGRSTHADRIATIRDVFERYRTMIDTHTADGLKVAREHLRP
GVPMVVLETAQPIKFGESIREALGQEPSRPAAFDGLEALPQRFEVVDANAQQVKDFIAAH
TGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaattacatctccacgcgcggcgccggcatcggcgagcgccatacgttctccgacatc
ctgctcggcggcctcgcgaaggacggcgggctctatctgccgagcgagtatccgcaggtg
agcgcggacgagctcgcgcgctggcgcacgctgccgtacgcggatctcgcgttcgagatc
ctgtcgaagttctgcgacgacatcgccgccgccgacctgcgcgcgatcacgcgccgcacg
tacacggccgacgtgtaccgccacgcgcgccgcggcgggaacgcggccgacatcacgccg
ctcacgacgctcggcaccgagaacggcgcgcccgtctcgctgctcgagctgtcgaacggc
ccgacgctcgcgttcaaggacatggcgatgcagttgctcggcaatctgttcgagtacacg
ctcgccaagcacggcgaaacgctgaacatcctcggcgcgacgtcgggcgacacgggcagc
gcggccgaatacgcgatgcgcggcaaagagggcgtgcgcgtgttcatgctgtcgccgcac
aagaagatgagcgcgttccagaccgcgcagatgtacagcctgcaggacccgaacatcttc
aacctcgcggtgaacggcgtgttcgacgactgccaggacatcgtgaaggccgtgtcgaac
gatcacgcgttcaaggcgcagcagaagatcggcaccgtcaattcgatcaactgggcgcgc
gtcgtcgcgcaggtcgtctactacttcaagggctacttcgcggcgacgcggtcgaatgac
gagcgcgtgtcgttcacggtgccgtcgggcaatttcggcaacgtctgcgcgggccacatc
gcgcgcatgatggggctgccgatcgagaagctcgtcgtcgcgacgaacgagaacgacgtg
ctcgacgagtttttccgcacgggcgcgtaccgcgtgcgcagcgcccaggacacgtatcac
acgagcagcccgagcatggacatctcgaaggcgtcgaacttcgagcgcttcgtgttcgat
ctgctcggccgcgatccggcgcgtgtcgtccagctgtttcgcgatgtcgagcaaaagggc
ggcttcgatctcgcggcgagcggcgatttcgcgcgcgtcgccgagttcggcttcgtgtcg
ggccgcagcacgcacgcggaccggatcgcgacgatccgcgacgtgttcgagcgctaccgc
acgatgatcgacacgcatacggccgacggcctgaaggtcgcgcgcgagcatctgcggccg
ggcgtgccgatggtcgtgctcgagaccgcgcagccgatcaagttcggcgaatcgattcgc
gaggcgctcgggcaggagccgtcgcggcctgccgcgttcgacgggctcgaggcgctgccg
cagcgcttcgaggtcgtcgacgcgaacgcgcagcaagtgaaggacttcatcgccgcgcat
acgggcgcgtga

DBGET integrated database retrieval system