KEGG   Burkholderia thailandensis E264: BTH_I2325Help
Entry
BTH_I2325         CDS       T00311                                 

Definition
(GenBank) nitrous-oxide reductase
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00910  Nitrogen metabolism
bte01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BTH_I2325
Enzymes [BR:bte01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     BTH_I2325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COX2 Cupredoxin_1 DUF5352
Motif
Other DBs
NCBI-ProteinID: ABC36800
UniProt: Q2SW53
Position
I:complement(2614751..2616823)
Genome map
AA seq 690 aa AA seqDB search
MSRCGANRHRSAWITGIESGNGSWPGVENESMSENVMANSKENTEAAAAPQDARRRKFLA
SSAVAGLAGASLSLGLAGCNKGGDASTAAAGGASAASGANPAPAIDFSKYEVHPGKLDTY
YAFSSGGHSGDLRVHGLPSGREIRRIPVYNIDCMSGWGITNESRKIIGTKANGQLEYFTG
DTHHVHMSYTDGTYDGKYIFVNDKINARIARVRLDTMECDAITPLPNVQGFHGIFPDKRD
PLDDKINYTTRVFCGNEFHIPHPNDGRDLNDPKKYYCLFTCVDAKTMQPRWQVKIDGNMD
LVATSYDGKLACSNQYNTENGVHYEEMMAAERDACVFFHVARIEEAVKNGRFFKIGNSPV
PVVDGTRAANADPKTALTCYVPVPKNPHGVNASPDGKYYACSGKLSPTATLISHELMLKW
FAGELKEPRDAVVAEPEIGLGPLHTGFDGKGYAYTTLFLDSQIVKWSVDEAIKAYKGDKA
AKVVVDRIDVHYQPGHGFTSMGETKEPDGQFFISDNKFSKDRYLPVGPLHPDSAQLIDIS
GEKMQLVADHPTYPEPHDSIVVRRDIIKTRQIYTLDEFPLAVKNAKDSRVERHGRKVTVY
LTSQAPTFGLREWTVKKGDEVTIILTNLDKVEDLTHGFAIPFYNINFVVHPQQTQSVTFI
ADKPGVFWCFCTNFCHALHLEMRSRMLVEA
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgcgatgcggcgcaaatcgtcaccggtcagcctggattaccggtatcgaaagcgga
aacgggtcttggcccggcgttgaaaacgaatcaatgagtgagaatgtgatggctaattcg
aaggaaaacactgaagcggcggcagcgccgcaggacgcgcggcggcgcaagttcctcgcg
tcgtcggcggttgcggggctcgcgggcgcgagcctgtcgctcggcctcgcgggctgcaac
aagggcggcgacgcatccaccgcggcggcgggcggcgcgagcgcggcgagcggcgcgaac
cccgcccccgcgatcgacttcagcaaatacgaagtgcatccgggcaagctcgatacgtac
tacgcgttctcaagcggcggccactcgggcgacctgcgcgtgcacggcctgccgtccgga
cgcgagatccggcgcattcccgtctacaacatcgattgcatgtccggctggggcatcacg
aacgaatcgcgcaagatcatcggcacgaaggccaacggccagctcgagtacttcacgggc
gacacgcatcacgtgcacatgtcctatacggacggcacgtacgacggcaagtacatcttc
gtcaacgacaagatcaacgcgcgcatcgcgcgcgtgcgcctcgacacgatggaatgcgac
gcaatcacgccgttgccgaacgtgcagggctttcacggcatcttcccggacaagcgcgac
ccgctcgacgacaagatcaactacacgacgcgcgtgttctgcggcaacgagttccacatt
ccgcacccgaacgacggccgcgacctgaacgatccgaagaagtactactgcctgttcacg
tgcgtcgacgcgaagacgatgcagccgcgctggcaggtgaagatcgacggcaacatggac
ctcgtcgcgacgtcgtacgacggcaagctcgcgtgctcgaaccagtacaacaccgagaac
ggcgtccattacgaggagatgatggccgccgagcgcgacgcgtgcgtgttcttccacgtc
gcgcgcatcgaggaggcggtgaagaacggcaggttcttcaagatcggcaattcgcccgtg
cccgtcgtcgacggcacgcgcgcggcgaacgccgacccgaagacggccctcacctgctac
gtgcccgtgccgaagaatccgcacggcgtgaacgcatcgcccgacggcaagtattacgcg
tgctcgggcaagctgtcgcccaccgcgacgctgatctcgcacgagctgatgctcaagtgg
ttcgcgggcgagctgaaggagccgcgcgacgccgtcgtcgcggagccggagatcggcctc
gggccgctgcacacgggcttcgacggcaagggctacgcgtacacgacgctctttctcgac
agccagatcgtcaagtggagcgtcgacgaggcgatcaaggcatacaagggcgacaaggcg
gcgaaggtcgtcgtcgaccggatcgacgtgcactatcaaccgggccacggcttcacgtcg
atgggcgagacgaaggagccggacggccagttcttcatctcggacaacaaattctcgaag
gaccgctacctgcccgtcgggccgctgcatccggacagcgcgcaactgatcgacatcagc
ggcgagaagatgcagctcgtcgccgatcacccgacgtatccggagccgcacgactcgatc
gtcgtgcgccgcgacatcatcaagacgcggcagatctacaccctcgacgagttcccgctc
gcggtgaagaacgcgaaggacagccgcgtcgagcggcacggcaggaaggtcaccgtctat
ctgacgtcgcaggcgccgaccttcgggctgcgcgaatggaccgtgaagaaaggcgacgag
gtcacgatcatcctgaccaatctcgacaaggtggaggacttgacgcacggcttcgcgatt
ccgttctacaacatcaacttcgtcgtgcatccgcagcagactcaatcggtgacgttcatc
gcagacaagcccggcgtgttctggtgcttctgcacgaacttctgccacgcgctgcacctc
gagatgcgctcgcggatgctggtcgaggcgtag

DBGET integrated database retrieval system