KEGG   Burkholderia thailandensis E264: BTH_I2406Help
Entry
BTH_I2406         CDS       T00311                                 

Definition
magnesium-chelatase subunit D/I family protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bte  Burkholderia thailandensis E264
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BTH_I2406
Enzymes [BR:bte01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     BTH_I2406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(2735802..2737052)
Genome map
AA seq 416 aa AA seqDB search
MPAAYPFSALIGQAALQQALLLVAVDPGLGGVLVAGPRGTAKSTAARALAELLPEGRFVT
LPLSATDEQVTGSLDLASALADNAVRFSPGLVARAHLGVLYVDEINLLPDALVDALLDAA
ASGVNTVERDGVSHSHAARFALVGTMNPEEGELRPQLLDRFGLMVELANCYDAATRQRIV
KARLAFDLDPHGFREHYRDAQAALVAKIRAARAALPALAFDDAAHARVAELCIDAAVDGL
RGDLVMLRAARALAALDGAASVAAAHVERVAADVLRHRRTRFESQPEFQPEFQPEFQPGS
QPEARLGPQPDSRSGGGHALGGLADAAEAEAARAPTPRDARPREAADARSAGASGSAHPP
ARASSDAERRAAGDRDASRDGGRGPAVDDGDWGYLPPEPAGIAPVKGVIPLPLKKR
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
ttgccggccgcctatccgttttccgcgctgatcggccaggcggcgttgcagcaggcgctg
ctgctcgtggccgtcgatccgggcctgggcggcgtgctcgtcgccggcccgcgcggcacc
gcgaagtcgaccgccgcgcgcgcgctcgccgagctgctgcccgaggggcgcttcgtcacg
ctgccgctgtcggccaccgacgagcaggtgacgggctcgctcgatctcgcgagcgcgctc
gccgacaacgcggtgcgcttctcgcccggcctcgtcgcacgcgcgcatctcggcgtgctg
tacgtcgacgagatcaacctgctgccggacgcgctcgtcgacgcattgctcgacgcggcc
gcgagcggcgtcaacacggtcgagcgcgacggcgtgtcgcacagtcacgcggcgcgcttc
gcgcttgtcggcacgatgaatccggaagagggagaactgcggccgcaactgctcgaccgc
ttcgggctgatggtcgagctcgcgaactgctacgacgcggcgacgcggcagcggatcgtc
aaggcgcggctcgcgttcgatctcgatccgcatggctttcgcgaacactatcgcgacgcg
caggcggcgctcgtcgcgaaaatacgcgcggcgcgcgcggcgctgccggcgctcgcgttc
gacgatgccgcgcacgcgcgtgtcgccgagctgtgcatcgacgcggccgtcgacgggctg
cgcggcgacctcgtgatgctgcgcgccgcgcgggcgctcgcggcgctcgacggggcggcg
agcgtcgctgcggcgcacgtcgagcgcgtcgccgccgacgtgctgcgccatcgacgcacg
cggttcgaatctcaacccgaatttcaacccgaatttcaacccgaatttcaacccggatct
cagccggaggctcggctcgggcctcagcccgactcgcgatcgggcggcggccacgcgctg
ggcgggctcgcggatgccgccgaagccgaagccgcgcgcgcgccgacgcctcgcgacgcg
cggccgcgcgaggcggccgacgcgcggtccgccggcgcgagcggatcggcgcatccccct
gcgcgcgcgtcgtccgacgcggaacggcgcgcggcgggcgatcgcgacgcgtcgcgcgac
ggcggccgcgggccggccgtcgacgacggcgactggggctatctgccacccgagccggcg
ggcatcgcgcccgtcaagggcgtgatcccgctgccgctaaaaaaacgctga

DBGET integrated database retrieval system