KEGG   Burkholderia thailandensis E264: BTH_I2555Help
Entry
BTH_I2555         CDS       T00311                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bte  Burkholderia thailandensis E264
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BTH_I2555 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTH_I2555 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    BTH_I2555 (sucB)
Enzymes [BR:bte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BTH_I2555 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2913370..2914647)
Genome map
AA seq 425 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQVIATIDTEAKAGAAAAAAGAAEVQPAAAPAAAPAPAAQPAAAAASSTA
SASPAASKLMAEKGLGAADVAGSGRDGRITKGDVLSAGSAPKAAPAAAPAKAAAKPSLPD
VKVPASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKY
KDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLV
VPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINP
PQSAILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPAR
LLLDL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctctccgaatcggtttcggaagcgaccatg
ctgcagtggaagaagaagcccggcgaagccgtcgcgcaagacgaaatcctgatcgagctc
gagaccgacaaggtcgtgctcgaagtgccggcgcccgccgcgggcgtgctcgcgcaagtg
ctgcagaacgatggtgacacggtcgtcgccgaccaggtgatcgcgacgatcgacaccgag
gcgaaggcaggtgcggccgcagcggcagcaggcgcggccgaagtccagccggccgccgcg
cccgccgccgcgccggcgcccgccgcgcagccggccgccgccgccgcgtcgagcaccgcg
tccgcgtcgcccgccgcatcgaagctgatggccgagaagggcttgggcgccgccgacgtc
gccggctcgggccgcgacggccgcatcacgaagggcgacgtgctgtccgcgggcagcgcg
ccgaaggccgcaccggccgccgcgccggcgaaggccgcggcaaagccgtcgctgccggac
gtgaaggtgccggcgtcggcgacgacgtggctcaacgaccgtccggagcagcgcgtgccg
atgtcgcgcctgcgcgcgcgcattgccgagcgtctgctcgaatcgcagcagaccaacgcg
atcctcacgacgttcaacgaagtgaacatgcagccggtgatggacctgcgcgcgaagtac
aaggacaagttcgagaaggaacacggcgtgaagctcggcttcatgtcgttcttcgtgaag
gcggccgttcacgcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggcaacgac
atcgtctaccacggctacttcgacatcggcatcgcggtcggttcgccgcgcggcctcgtc
gtgccgatcctgcgcaacgcggatcagctgagcctcgccgagatcgagaagaagatcgcc
gaattcggccagaaggcgaaggacggcaagctgtcgatcgaggaaatgacgggcggcacg
ttctcgatctcgaacggcggcgtgttcggctcgatgctgtcgacgccgatcatcaacccg
ccgcagtcggccatcctcggcgtgcacgcgacgaaggagcgcccggtcgtggagaacggc
cagatcgtgatccgtccgatcaactacctcgcgctgtcgtacgaccaccggatcatcgac
ggccgtgaagcggtgctgtcgctcgtcgcgatgaaggacgcgctcgaagatccggcgcgc
ctgctgctcgacctgtaa

DBGET integrated database retrieval system