KEGG   Burkholderia thailandensis E264: BTH_I2634Help
Entry
BTH_I2634         CDS       T00311                                 

Gene name
galU-2
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bte  Burkholderia thailandensis E264
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bte00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bte00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bte00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bte00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:3002599..3003483
Genome map
AA seq 294 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLELVRSIKPSHVDCFYVRQPEALGLGHAVLCAEK
LVADNPFAVILADDLLDGDPPVMKQMVDVFDHYHSSVIGVEEIPPEDTKSYGIVDGKEWE
DSIIKMSAIVEKPAPEVAPSNLGVVGRYVLKPRIFDHLRALKPGAGGELQLTDAIQALLA
DEQVLAYKYRGTRFDCGSKLGYLKATVEFALRHPEVKTEFEAYLRSRSETRHDA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccaaggcggttttcccggtcgcgggcctgggcacgcggttcctgccc
gccaccaaggcgagcccgaaggaaatgctgcccgtcgtcgacaaaccgttgatccagtac
gcggtggaagaagcaattgcagccggcatcaccgagatgatcttcgtgacgggccgcagc
aagcgtgcgatcgaggaccatttcgacaagtcgtacgagatcgaagcggagctcgaagcg
cgcggcaaggaaaagctgctcgagctcgtgcgcagcatcaagccgagccatgtcgactgc
ttctacgtgcgccagccggaagcgctcggcctcggccatgcggtgctgtgcgcggagaag
ctcgtcgcggacaacccgttcgcggtgatcctcgccgacgatttgctcgacggcgatccg
cccgtgatgaagcagatggtcgacgtgttcgaccactatcacagctcggtgatcggcgtc
gaggagatcccgcccgaggacacgaagtcgtacgggatcgtcgacggcaaggaatgggaa
gactcgatcatcaagatgtcggcgatcgtcgagaagcccgcgcccgaagtcgcgccgtcg
aacctcggcgtcgtcggccgctacgtgctcaagccgcggatcttcgatcatctgcgcgcg
ctcaagccgggcgcgggcggcgagctgcagttgacggacgcgatccaggcgctcctcgcg
gacgaacaggtgctcgcatacaagtatcgcggcactcgcttcgactgcggcagcaagctc
ggctatctgaaggcgacggtcgagttcgcgctgcgccaccccgaagtgaagaccgagttc
gaagcgtatctgcgctcgcgcagcgaaacgcggcacgacgcatga

DBGET integrated database retrieval system