KEGG   Burkholderia thailandensis E264: BTH_I2634Help
Entry
BTH_I2634         CDS       T00311                                 

Gene name
galU-2
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bte  Burkholderia thailandensis E264
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BTH_I2634 (galU-2)
   00052 Galactose metabolism
    BTH_I2634 (galU-2)
   00500 Starch and sucrose metabolism
    BTH_I2634 (galU-2)
   00520 Amino sugar and nucleotide sugar metabolism
    BTH_I2634 (galU-2)
Enzymes [BR:bte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BTH_I2634 (galU-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:3002599..3003483
Genome map
AA seq 294 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLELVRSIKPSHVDCFYVRQPEALGLGHAVLCAEK
LVADNPFAVILADDLLDGDPPVMKQMVDVFDHYHSSVIGVEEIPPEDTKSYGIVDGKEWE
DSIIKMSAIVEKPAPEVAPSNLGVVGRYVLKPRIFDHLRALKPGAGGELQLTDAIQALLA
DEQVLAYKYRGTRFDCGSKLGYLKATVEFALRHPEVKTEFEAYLRSRSETRHDA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccaaggcggttttcccggtcgcgggcctgggcacgcggttcctgccc
gccaccaaggcgagcccgaaggaaatgctgcccgtcgtcgacaaaccgttgatccagtac
gcggtggaagaagcaattgcagccggcatcaccgagatgatcttcgtgacgggccgcagc
aagcgtgcgatcgaggaccatttcgacaagtcgtacgagatcgaagcggagctcgaagcg
cgcggcaaggaaaagctgctcgagctcgtgcgcagcatcaagccgagccatgtcgactgc
ttctacgtgcgccagccggaagcgctcggcctcggccatgcggtgctgtgcgcggagaag
ctcgtcgcggacaacccgttcgcggtgatcctcgccgacgatttgctcgacggcgatccg
cccgtgatgaagcagatggtcgacgtgttcgaccactatcacagctcggtgatcggcgtc
gaggagatcccgcccgaggacacgaagtcgtacgggatcgtcgacggcaaggaatgggaa
gactcgatcatcaagatgtcggcgatcgtcgagaagcccgcgcccgaagtcgcgccgtcg
aacctcggcgtcgtcggccgctacgtgctcaagccgcggatcttcgatcatctgcgcgcg
ctcaagccgggcgcgggcggcgagctgcagttgacggacgcgatccaggcgctcctcgcg
gacgaacaggtgctcgcatacaagtatcgcggcactcgcttcgactgcggcagcaagctc
ggctatctgaaggcgacggtcgagttcgcgctgcgccaccccgaagtgaagaccgagttc
gaagcgtatctgcgctcgcgcagcgaaacgcggcacgacgcatga

DBGET integrated database retrieval system