KEGG   Burkholderia thailandensis E264: BTH_I2668Help
Entry
BTH_I2668         CDS       T00311                                 

Definition
beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bte  Burkholderia thailandensis E264
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BTH_I2668
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BTH_I2668
Enzymes [BR:bte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BTH_I2668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:complement(3043952..3046051)
Genome map
AA seq 699 aa AA seqDB search
MKRRECRGNARGEDSVKMRKKSLVHLPVALAVTAMLGGCTGDDDAAIESRADAIVERMTT
RQKVGQKLMMAFRYWCPDGQPACTAGMTEFPAAARDALRDSGVGGVILFSNNLTGIEQTR
RLIDGIRAAPAADSPVGLLIGIDEEGGNVFRLPRVEATAFSGNMALGAAYEATRDDRLAY
DMGRVLAAEIAAVGFNVNFAPDVDVNSNPLNPVINVRAFGDDPATIGLLGRRMVQGMASE
RVIGTFKHFPGHGDTDTDSHYGLPVVIKSRADAYAIDLAPYRQAIESGEAPDMIMTAHIQ
YPSLDDTRVTTRTGEQMIAPATMSRRIQHDILRGEFGYRGVTITDALDMKGIADFFDEAD
AVIKVFQADVDIALMPVEFRTAADAGRLAALVDRVAAAVDSGRIDRAEFDSSVRRIVLTK
LRNGIVASDRGRPVDELASIGGPAHRAIERDLAQKSITVLRNENGTLPLQAAGRRIFILT
PWGEQAEAMRRRFVELGHPLATGAKLSAITWAEQQQAIDAADIVIVGTLSTGVTPVEHNG
DPNARVSPPAPAAALMRQAAPAKGEEEGSVIFDHVERADAATDVRARPSVLAAATAPSEA
QQMRNAMDYAKARRKTVIHVTMRAPYDAISYDDVADATLATYAYYGYEGGLRGPSLPAAV
DAMLGVERPVGKLPVAIHALNADGSTGPLRYPRGFGLRY
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgacgtgaatgccgcgggaatgcgcgcggcgaggattcggtgaagatgcgcaag
aaaagcttggttcatttgcccgtcgcgctcgcggtgacggcgatgctcggcgggtgcacg
ggcgacgacgacgcggcgatcgagtcgcgcgcggacgcgatcgtcgaacggatgacgacc
cggcagaaggtcggccagaagctgatgatggcgttccggtattggtgcccggacggccag
cctgcctgcacggccggcatgactgaatttccggccgccgcgcgcgacgcgttgcgcgat
agcggcgtcggcggcgtgatcctgttctcgaacaacctgacgggcatcgagcagacgcgc
cggctgatcgacggcattcgggccgcgcccgcggccgacagcccggtcggcctcctgatc
ggcatcgatgaggagggcggcaacgtgttccgcctgccgcgcgtcgaagcgaccgcgttt
tccggcaacatggcgctcggcgcggcatacgaggcgacgagggacgaccggctcgcgtac
gacatgggccgcgtgctcgcggccgaaatcgcggcggtcggcttcaacgtgaatttcgcg
ccggacgtcgacgtgaacagcaatccgctcaatccggtcatcaacgtgcgcgcgttcggc
gacgatccggcgacgatcggcctgctcggccggcgcatggtgcaggggatggcgagcgag
cgcgtgatcggcacgttcaagcattttcccgggcacggcgacacggacaccgattcgcac
tacggattgcccgtcgtgatcaagtcgcgcgccgacgcctacgcgatcgatctcgcgccg
taccggcaggcgatcgagtcgggcgaggcgcccgacatgatcatgaccgcgcacatccag
tatccgtcgctcgacgacacgcgcgtcacgacgcgcacgggcgagcagatgatcgcgccc
gcgacgatgtcgcggcgcatccagcacgatatcctgcgcggcgagttcggctaccggggg
gtgacgatcaccgatgcgctcgacatgaagggcatcgccgatttcttcgacgaggccgac
gcggtcatcaaggtgttccaggcggacgtcgacatcgcgctgatgcccgtcgagttccgc
acggcggccgacgcagggcgccttgcggcgctcgtcgatcgcgtggccgcggccgtcgat
tcgggccggatcgatcgcgccgaattcgacagctcggtgcgccggatcgtgctgacgaag
ctgcgcaacggcattgtcgcgtcggaccgcggccggccggtcgacgaactggcgtcgatc
ggcgggcccgcgcatcgcgcaatcgagcgcgacctcgcgcaaaagtcgatcacggtgctg
cgcaacgagaacggcacgctgccgctgcaggcggccggccggcggatcttcatcctgacg
ccgtggggcgagcaggcggaggcgatgcggcggcgcttcgtcgagctcggccatccgctc
gcgacgggcgcgaagctgagcgcgatcacgtgggccgaacagcagcaggcgatcgatgcg
gccgacatcgtgatcgtcggcacgctgtcgacgggcgtgacgcccgtcgagcacaacggc
gatccgaatgcgcgggtgagcccgccggcgcccgccgccgcgctgatgcggcaggccgcg
cccgcgaagggcgaggaggagggctcggtgatcttcgaccacgtcgagcgggcggacgcg
gcgacggacgtccgcgcgcgcccgagcgtgctcgccgcggccacggcgccgagcgaggcg
cagcagatgcgcaatgcgatggactacgcgaaggcgcggcgcaagaccgtgatccacgtg
acgatgcgcgcgccgtacgacgcgatcagctacgacgacgtcgcggacgcgacgctcgcc
acatacgcgtactacggctacgaaggcggcttgcgcggcccgtcgctgcccgccgccgtc
gacgcgatgctgggcgtcgagcggccggtgggcaagctgccggtcgcgatccacgcgttg
aacgcggacggctcgacggggccgttgcgctatccgcgcggttttgggctgcggtactga

  All links  
No link information was found.   
DBGET integrated database retrieval system