KEGG   Burkholderia thailandensis E264: BTH_I2670Help
Entry
BTH_I2670         CDS       T00311                                 

Definition
di-heme cytochrome c peroxidase family protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bte  Burkholderia thailandensis E264
Brite
Enzymes [BR:bte01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BTH_I2670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3047059..3048447)
Genome map
AA seq 462 aa AA seqDB search
MRRPPRHACPNRSTFFAPRALGASVAAITLATGISACDANGPAATSAPAAAPRERASAPT
VASAPAVVDNQPQTRAQVYEAVKQMTALGRQLFLDPSLSGSGKLACASCHSPQRAFGPPN
ALPAQFGGDDLRQQGFRAVPTLKYLQKVPAFSEHYHESDDEGDESVDAGPTGGLTWDGRV
DGGAEQARAPLTSPFEMNSTPAKVARAVRAAPYARAFRAAFGARVLDDDRATFEAVLQAL
GTFEQAPDVFYPYTSKYDAYLAGRARLTRAELHGLQVFNDEKKGNCASCHVSRRGLDGSP
PQFSDFGLIAIGVPRNRELAVNRNPKFYDLGACGPERQDLKGRDEFCGLFRTPTLRNVAL
KKTFFHNGVYHSLDDVLRFYAERDTHPEKFYPVTHGVVRKFDDLPKRYWKNLNDEPPFDR
KRGDPPAMTDAEIKDVIAFLGTLTDGYDPRAQPAGESAGGSR
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcccgccgcgacacgcttgcccgaatcgttcgaccttcttcgcgccgcgcgcg
ttgggcgcatccgtcgcggcgatcacgctcgcgacgggcatctccgcttgcgacgcgaac
gggccggccgctacgtccgcacccgccgccgcgccccgcgaacgggcgagcgcgcccacc
gtcgccagcgcgcccgccgtcgtcgacaatcagccgcagacgcgcgcgcaggtgtacgag
gcggtgaagcagatgacggcgctcggccggcagttgtttctcgatccgtcgctgtcgggc
agcggcaagctcgcgtgcgcgtcttgccacagcccgcagcgtgcgttcgggccgccgaac
gcgctgcccgcgcaattcggcggcgacgatctgcgccagcagggatttcgcgcggtgccg
acgctcaagtatctgcaaaaggtgccggcgttcagcgagcactatcacgaatcggacgac
gagggcgacgagagcgtcgacgccggcccgacgggcgggctcacgtgggacggccgcgtc
gacggcggcgcggagcaggcgcgcgcgccgctcacgtcgccgttcgagatgaacagcacg
cccgcgaaggtcgcgcgcgcggtgcgggccgcgccgtacgctcgcgcgtttcgggcggcg
ttcggcgcgcgcgtgctcgacgacgatcgcgcgacgttcgaggcggtgctgcaggcgctc
ggcacgttcgagcaggcgcctgacgtgttctatccgtacacgagcaagtacgacgcgtat
ctggcgggccgcgcgcgactgacgcgcgccgagctgcacgggctgcaggttttcaacgac
gagaagaagggcaactgcgcgagctgccatgtgagccgtcgcgggctcgacggctcgcct
ccgcagttcagcgatttcgggctcatcgcgatcggcgtgccgcgcaatcgcgagctcgca
gtgaatcggaatccgaagttttacgatctcggcgcatgcgggcccgagcgtcaggacctg
aagggccgcgacgagttctgcgggctgttccgcacgccgacgctgcgcaacgtcgcgctg
aagaagacgttctttcacaacggcgtctatcactcgctcgacgatgtgctgcgcttctac
gccgagcgcgacacgcatccggagaagttctatccggtgacgcacggcgtcgtccggaag
ttcgacgatttgccgaagcgctactggaagaacctgaacgacgagccgccgttcgaccgc
aagcgcggcgatccgcccgcgatgaccgacgcggagatcaaggacgtgatcgcgttcctc
ggcacgctcaccgacggttacgatccgcgcgctcagccggcaggcgaatcggccggcggc
agtcgctaa

DBGET integrated database retrieval system