KEGG   Burkholderia thailandensis E264: BTH_I2753Help
Entry
BTH_I2753         CDS       T00311                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00010  Glycolysis / Gluconeogenesis
bte00620  Pyruvate metabolism
bte00640  Propanoate metabolism
bte00680  Methane metabolism
bte01100  Metabolic pathways
bte01110  Biosynthesis of secondary metabolites
bte01120  Microbial metabolism in diverse environments
bte01130  Biosynthesis of antibiotics
bte01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTH_I2753
   00620 Pyruvate metabolism
    BTH_I2753
   00640 Propanoate metabolism
    BTH_I2753
  Energy metabolism
   00680 Methane metabolism
    BTH_I2753
Enzymes [BR:bte01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BTH_I2753
Lipid biosynthesis proteins [BR:bte01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BTH_I2753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABC36913
UniProt: Q2SUY3
Position
I:3164675..3166300
Genome map
AA seq 541 aa AA seqDB search
MLPHAADYAELVDRFAWRVPARYNIGVDACDKWADGSGRVALIHEHADGFITRYTFDELR
SGSNRLANSFARAGVKRGDRIGILLAQCPETAIAHLAAYKLGAIAVPLFTLFGADALEFR
LGDSGAVAVVTDRAGYEKIAPLHASLPSLATIYCVDGAPDLAEPGVLAFDAALAAESDTF
QPADTSADDPALIIYTSGTTGKPKGALHAHRVLLGHLPGVEMSQNLFPARARLFWTPADW
AWIGGLLDVLLPSLHHGVPVLARRFEKFDGAAAFELLARHGVTHTFLPPTALKLMRAAVT
QPRGHYALALESVASGGESLGAELVAWGRDAFGVTINEFYGQTECNVVLSSCGALFEPRA
GTIGKAVPGHRVAIVDDAGNVLPPGAEGNIGVRAPDPVMFIGYWRKPDATREKFAGGFLL
TGDVGVADADGFVRFVGRDDDVITSAGYRIGPSPIEDCLLKHPAVRMAAVVGVPDATRTE
IVKAFVVLNAGYEANDALARELQAHVKTRLAAHEYPRAVAFVDNLPMTATGKIIRRALRD
A
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgctgccccatgccgccgattacgccgagctcgtcgaccgcttcgcatggcgcgttccc
gcgcgctacaacatcggcgtcgacgcatgcgacaagtgggccgacggcagcggccgcgtc
gcactgattcacgagcatgcggacggcttcattacacgctacacgttcgacgagttgagg
agcggctctaatcgactcgcgaacagcttcgcacgcgcgggcgtgaagcgcggcgaccgg
atcggcatcctgctcgcgcaatgcccggaaacggcgatcgcccatctggccgcctacaag
ctaggcgcgatcgcagtccctctcttcacgctgttcggcgcggacgcgctcgaattccgc
ctcggcgacagcggcgccgtcgcagtcgtcaccgatcgcgccggctacgagaagatcgcg
ccgctgcacgcatcgctgccgtcactcgcgacgatctactgcgtcgacggcgcgcccgat
ctcgccgagcccggcgtgctcgcattcgatgcggcgctcgcggccgaatcggacacgttt
cagccggcggacacatcggccgacgatcccgcgctcatcatctacacgtccggcacgacg
ggcaaacccaagggcgcgctgcacgcgcaccgggtgctgctcggccatctgccgggcgtc
gagatgtcgcaaaacctgtttcccgcgcgtgcgcgcctgttctggacgcccgccgactgg
gcgtggatcggcgggctcctcgacgtcctgctgccgtcgctgcatcacggcgtgccggtg
ctcgcgcgacgcttcgagaaattcgacggagcagccgcgttcgagctgctcgcgcggcac
ggcgtcacgcacacgttcttgccgccgaccgcactgaagctgatgcgcgcggccgtcacg
cagcctcgcgggcactacgcgctcgcgctcgaatcggtggcgagcggcggcgagtcgctc
ggcgccgaactcgtcgcatggggccgcgatgcgttcggcgtgacgatcaacgagttctac
ggccagaccgaatgcaacgtcgtgttgtcgtcgtgcggcgcgctgttcgagccgcgcgcg
ggcacgatcggcaaggccgtgcccggacatcgcgtcgcgatcgtcgacgatgcaggcaac
gtgctgccgcccggcgccgagggcaacatcggcgtacgtgcgcccgaccccgtgatgttc
atcggctattggcgcaagcctgatgcaactcgcgagaaattcgccggcggctttctgctg
acgggcgacgtcggcgtcgccgacgccgacggcttcgttcgctttgtcggccgcgacgac
gacgtgatcacgagcgccggctaccggatcggcccgagtccgatcgaggactgtctactc
aagcacccggccgtacgaatggcggctgtcgtcggcgtgcccgacgcgacccgcaccgag
atcgtcaaggcgttcgtcgtgctgaacgccggctacgaagcaaacgacgcgctcgcacgc
gagttgcaggcgcacgtgaagacacggctcgccgcacacgaatatccgcgcgcggtcgca
ttcgtcgacaacctgccgatgaccgcgacgggcaagatcatccgccgcgcgctgcgcgac
gcttga

DBGET integrated database retrieval system