KEGG   Burkholderia thailandensis E264: BTH_I2753Help
Entry
BTH_I2753         CDS       T00311                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bte  Burkholderia thailandensis E264
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BTH_I2753
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTH_I2753
   00620 Pyruvate metabolism
    BTH_I2753
   00640 Propanoate metabolism
    BTH_I2753
  Energy metabolism
   00680 Methane metabolism
    BTH_I2753
Enzymes [BR:bte01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BTH_I2753
Lipid biosynthesis proteins [BR:bte01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BTH_I2753
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:3164675..3166300
Genome map
AA seq 541 aa AA seqDB search
MLPHAADYAELVDRFAWRVPARYNIGVDACDKWADGSGRVALIHEHADGFITRYTFDELR
SGSNRLANSFARAGVKRGDRIGILLAQCPETAIAHLAAYKLGAIAVPLFTLFGADALEFR
LGDSGAVAVVTDRAGYEKIAPLHASLPSLATIYCVDGAPDLAEPGVLAFDAALAAESDTF
QPADTSADDPALIIYTSGTTGKPKGALHAHRVLLGHLPGVEMSQNLFPARARLFWTPADW
AWIGGLLDVLLPSLHHGVPVLARRFEKFDGAAAFELLARHGVTHTFLPPTALKLMRAAVT
QPRGHYALALESVASGGESLGAELVAWGRDAFGVTINEFYGQTECNVVLSSCGALFEPRA
GTIGKAVPGHRVAIVDDAGNVLPPGAEGNIGVRAPDPVMFIGYWRKPDATREKFAGGFLL
TGDVGVADADGFVRFVGRDDDVITSAGYRIGPSPIEDCLLKHPAVRMAAVVGVPDATRTE
IVKAFVVLNAGYEANDALARELQAHVKTRLAAHEYPRAVAFVDNLPMTATGKIIRRALRD
A
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgctgccccatgccgccgattacgccgagctcgtcgaccgcttcgcatggcgcgttccc
gcgcgctacaacatcggcgtcgacgcatgcgacaagtgggccgacggcagcggccgcgtc
gcactgattcacgagcatgcggacggcttcattacacgctacacgttcgacgagttgagg
agcggctctaatcgactcgcgaacagcttcgcacgcgcgggcgtgaagcgcggcgaccgg
atcggcatcctgctcgcgcaatgcccggaaacggcgatcgcccatctggccgcctacaag
ctaggcgcgatcgcagtccctctcttcacgctgttcggcgcggacgcgctcgaattccgc
ctcggcgacagcggcgccgtcgcagtcgtcaccgatcgcgccggctacgagaagatcgcg
ccgctgcacgcatcgctgccgtcactcgcgacgatctactgcgtcgacggcgcgcccgat
ctcgccgagcccggcgtgctcgcattcgatgcggcgctcgcggccgaatcggacacgttt
cagccggcggacacatcggccgacgatcccgcgctcatcatctacacgtccggcacgacg
ggcaaacccaagggcgcgctgcacgcgcaccgggtgctgctcggccatctgccgggcgtc
gagatgtcgcaaaacctgtttcccgcgcgtgcgcgcctgttctggacgcccgccgactgg
gcgtggatcggcgggctcctcgacgtcctgctgccgtcgctgcatcacggcgtgccggtg
ctcgcgcgacgcttcgagaaattcgacggagcagccgcgttcgagctgctcgcgcggcac
ggcgtcacgcacacgttcttgccgccgaccgcactgaagctgatgcgcgcggccgtcacg
cagcctcgcgggcactacgcgctcgcgctcgaatcggtggcgagcggcggcgagtcgctc
ggcgccgaactcgtcgcatggggccgcgatgcgttcggcgtgacgatcaacgagttctac
ggccagaccgaatgcaacgtcgtgttgtcgtcgtgcggcgcgctgttcgagccgcgcgcg
ggcacgatcggcaaggccgtgcccggacatcgcgtcgcgatcgtcgacgatgcaggcaac
gtgctgccgcccggcgccgagggcaacatcggcgtacgtgcgcccgaccccgtgatgttc
atcggctattggcgcaagcctgatgcaactcgcgagaaattcgccggcggctttctgctg
acgggcgacgtcggcgtcgccgacgccgacggcttcgttcgctttgtcggccgcgacgac
gacgtgatcacgagcgccggctaccggatcggcccgagtccgatcgaggactgtctactc
aagcacccggccgtacgaatggcggctgtcgtcggcgtgcccgacgcgacccgcaccgag
atcgtcaaggcgttcgtcgtgctgaacgccggctacgaagcaaacgacgcgctcgcacgc
gagttgcaggcgcacgtgaagacacggctcgccgcacacgaatatccgcgcgcggtcgca
ttcgtcgacaacctgccgatgaccgcgacgggcaagatcatccgccgcgcgctgcgcgac
gcttga

DBGET integrated database retrieval system