KEGG   Burkholderia thailandensis E264: BTH_I2850Help
Entry
BTH_I2850         CDS       T00311                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bte  Burkholderia thailandensis E264
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bte00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BTH_I2850
Enzymes [BR:bte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BTH_I2850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3268223..3270922)
Genome map
AA seq 899 aa AA seqDB search
MSVVDERFAWTGGLADRLPEPADFGLALAEGFARRIGMLSRRVGASAAAARWAARAAFAA
SRATAAGHVCVSLRALAQRYDEPFADVRDALAASGVTAFDSIARGAERPLVVDRDGRLYL
ARYFEYETRLASALVARARCGGAQAGDAGELMPEALGERLVRYFGPQKERGVDWQRVAAL
VALTGRVTIVSGGPGTGKTTTVVGVIACLLDAHPDLRIALAAPTGKAAQRMQEALHARAG
SLPAELAARLPRTSYTLHRLLGGGPGGRFAHHRDNPLPYDLVVVDEASMIDVALAAHLLD
ALAPNARLVLLGDKDQLAAVEAGAVFAELSARPAFSSATCATIARALGVGEAEFVAALPQ
GGVLHAADAANAGASADARATSVDTGAAALAARATGAVAAAKVAPEAPAQRAPAPRAGRR
GGGRESKRGVDDAQGWLFAFEDEDAFSAEASGAGASGADESGAEALGVGTSGADAQDVGT
SSIDRRDDRASLDTPRRRRDALATHVRADSPGARDIENAAYVHAQADEAGVADLPWDASF
AEPAAWIEAGELEWLDNADFSISEGASANAGSDERRTATATDASAGGARAQAGRVPAAHA
GPDIEPQASAPANPAGAPSPDADAAAAPLTDCVIWLERNYRFGLDSPIGRLSLAIRRGAV
QDALDALSTADDAAARWCDDGGATLSAATVGQLARGFAGYAAALRDALATPDPDPLPLFD
VLNRFRVLCATRTGARGADEVNALVAAEVRRAVRVPLALGAHWFAGRPVMVTRNDYALGL
FNGDIGIALPGARGALRVWFRGADGRARAVSPAALPPHDTAFALTVHKSQGSEFDDAALV
LPASFNRVLSRELVYTAITRARSRVRVIGARAVLALAIATRTARDSGLAARIADALRTR
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtggtcgacgaacgtttcgcatggacgggcggtctggcggaccgcctgcccgag
ccggccgatttcgggctcgcgcttgccgaaggtttcgcgcgccggatcgggatgctgtcg
cgccgcgtcggcgcgagcgccgcggccgcgcgctgggcggcgcgcgcggcgttcgccgcg
agccgcgcgacggcggcggggcacgtctgcgtgtcgctgcgcgcgctcgcgcaacgctac
gacgagccgttcgccgacgtgcgcgacgcgctcgccgcgagcggcgtgaccgcgttcgac
agcatcgcgcgcggcgccgagcgtccgctcgtcgtcgaccgcgacggccggctgtatctc
gcgcgctacttcgaatacgagacgcggcttgcgagcgcgctcgtcgcgcgcgcccggtgc
ggcggcgcgcaagcgggcgatgccggcgaattgatgcccgaggcgctcggcgaacggctc
gtccgctatttcgggccgcagaaggagcggggcgtcgactggcagcgcgtcgcggcgctc
gtcgcgctcacgggccgggtgacgatcgtgagcggcgggccgggcaccggcaagacgacg
acggtcgtcggcgtgatcgcgtgtctgctcgacgcgcaccccgacttgcggatcgcgctc
gccgcgccgaccggcaaggcggcgcagcggatgcaggaggcgctgcacgcacgcgccggc
agcctgccggccgagctcgcggcgcgtctgccgcgcacgtcctatacgctgcaccggctg
ctgggcggcggtccgggcgggcgcttcgcgcatcatcgcgacaacccgttgccatacgat
ctcgtcgtcgtcgacgaggcgtcgatgatcgacgtcgcgctcgccgcgcacttgctcgat
gcgctcgcgccgaacgcgcgcctcgtgctgctcggcgacaaggatcagctcgcggccgtc
gaggcgggtgcggtgtttgccgagctgagcgcgcgtcccgcgttcagctcggcgacgtgc
gcgacgattgcgcgcgcgctcggcgtcggagaggccgaattcgtggcggcgctgccgcag
gggggcgttctgcatgcggccgatgcggcgaacgcgggcgcgagcgcggacgcacgcgcg
acttcggtcgacacgggcgcggcggcgctggccgcacgagcgacgggtgccgtcgccgcg
gcgaaggtcgcgccggaagccccggctcagcgcgcgccggcgccgcgcgcgggccggcgc
ggcggcgggcgcgaatcgaaacggggtgtcgacgacgcgcagggatggctgttcgcgttc
gaagacgaagatgcgttcagcgcggaggcgtcaggtgccggtgcgtcaggcgccgatgag
tcgggcgcggaggcgttgggcgtcggtacgtcgggtgccgatgcgcaggatgtcggcacg
tcgagcatcgatcgccgcgacgatcgtgcatcgcttgataccccgcgccgccggcgtgac
gcgctcgccacgcatgttcgagcggattcgccgggcgcgcgcgacattgaaaacgccgcg
tacgtgcacgcacaggccgatgaagccggcgtcgccgatttgccgtgggatgcgtctttc
gccgagcccgccgcgtggatcgaggctggcgaactcgagtggctcgacaacgcggacttt
tcgatatccgaaggcgcttcggcgaatgccggctccgatgagcggcgaaccgcgacggca
acggatgcaagcgccggcggcgcgcgcgcacaggccggccgggtgcccgccgcccacgcc
gggccggatatcgaaccgcaagcgtcggcaccggcgaacccggccggggccccgtcaccg
gacgccgatgccgccgccgcgccgttgaccgactgcgtcatctggctcgaacgcaattac
cgcttcggcctcgactcgccgatcggcaggctgtcgctcgcgatccgccgcggcgccgtg
caggacgcgctcgatgcgttgtcgacggccgacgacgcggccgcgcgctggtgcgacgac
ggcggcgcgacgctgtcggccgcgacggtcgggcaactcgcgcggggcttcgccggctac
gcggccgcgttgcgcgacgcgctcgcgacgcccgatcccgatccgctgccgctcttcgac
gtgctcaaccgctttcgcgtgctctgcgcgacgcgaacgggcgcgcgcggcgcggacgag
gtcaacgcgctcgtcgcggccgaggtgcggcgagcggtgcgcgtgccgctcgcgctcggc
gcgcactggttcgcggggcggcccgtgatggtgacgcgcaacgattacgcgctcggactc
ttcaatggcgacatcggcattgcgctgcccggcgcgcgtggcgcgttgcgcgtctggttc
cgcggcgcggacggccgcgcgcgcgcggtgtcgcccgccgcgctgccgccgcacgatacg
gcgttcgcgctgaccgtccacaaatcgcagggctcggagttcgacgacgcggcgctggtc
ctgcccgcgtcgttcaaccgtgtgctgtcgcgcgagcttgtctacaccgcgatcacgcgc
gcgcgctcgcgcgtgcgcgtgatcggcgcgcgcgcggtgctcgcgctcgcgatcgcgacg
cgcacggcgcgcgattccggtctcgccgcacggatcgccgatgcgctgcgcacacgatag

DBGET integrated database retrieval system