KEGG   Burkholderia thailandensis E264: BTH_I2912Help
Entry
BTH_I2912         CDS       T00311                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bte  Burkholderia thailandensis E264
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BTH_I2912 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BTH_I2912 (trpC)
Enzymes [BR:bte01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BTH_I2912 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
I:3347622..3348407
Genome map
AA seq 261 aa AA seqDB search
MSDILDKIIAVKREEIAAALKSAPLEELKLQASARDSRDFVGALRGKHAAGHAAVIAEVK
KASPSKGVLRERFVPADIARSYAEHGAACLSVLTDEQFFQGSARYLEEARAACNLPVLRK
DFIVDPYQVLEARAMGADAILLIAAALDTPLMVDLEAYAHSLGLAVLVEVHNRDELSAAL
ELKTPLVGINNRNLRTFETTIDTTLGMLDAIPDDRIVVTESGILSRADVERMEAAGVHTF
LVGEAFMRAENPGAELARMFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctcgacaaaatcatcgccgtcaagcgcgaagagatcgccgccgcactc
aagagcgcgccgctcgaagaactgaagctgcaggcgtcggcgcgcgattcgcgcgacttc
gtcggcgcgctgcgcggcaagcatgcggccggacacgccgccgtcatcgccgaggtgaag
aaggcgagcccgtcgaaaggcgtgctgcgcgagcgcttcgtgccggccgacatcgcccgc
tcgtacgcggagcacggcgccgcatgcctgtcggtgctgaccgacgagcagttcttccag
ggcagcgcgcgctatctggaagaggcgcgcgccgcatgcaacctgcccgtgctgcgcaag
gacttcatcgtcgacccgtatcaggtgctcgaagcgcgcgcgatgggcgcggacgcgatc
ctgctgatcgccgccgcactcgatacgccgctgatggtcgatctcgaggcgtacgcgcat
tcgctcgggctcgcggtgctcgtcgaggtgcacaaccgcgacgaactgagcgcggcgctc
gaactgaagacgccgctcgtcggcatcaacaaccgcaacctgcgcacgttcgagacgacg
atcgacacgacgctcggcatgctcgacgcgattccggacgaccgcatcgtcgtcaccgaa
tcgggcatcctgtcgcgcgcggacgtcgagcgaatggaagcggcgggcgtgcatacgttc
ctcgtcggcgaagcgttcatgcgcgccgagaatccgggcgcggaactcgcgcggatgttc
ttctga

DBGET integrated database retrieval system