KEGG   Burkholderia thailandensis E264: BTH_I2912Help
Entry
BTH_I2912         CDS       T00311                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bte01100  Metabolic pathways
bte01110  Biosynthesis of secondary metabolites
bte01130  Biosynthesis of antibiotics
bte01230  Biosynthesis of amino acids
Module
bte_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BTH_I2912 (trpC)
Enzymes [BR:bte01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BTH_I2912 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh
Motif
Other DBs
NCBI-ProteinID: ABC37677
UniProt: Q2SUI0
Position
I:3347622..3348407
Genome map
AA seq 261 aa AA seqDB search
MSDILDKIIAVKREEIAAALKSAPLEELKLQASARDSRDFVGALRGKHAAGHAAVIAEVK
KASPSKGVLRERFVPADIARSYAEHGAACLSVLTDEQFFQGSARYLEEARAACNLPVLRK
DFIVDPYQVLEARAMGADAILLIAAALDTPLMVDLEAYAHSLGLAVLVEVHNRDELSAAL
ELKTPLVGINNRNLRTFETTIDTTLGMLDAIPDDRIVVTESGILSRADVERMEAAGVHTF
LVGEAFMRAENPGAELARMFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctcgacaaaatcatcgccgtcaagcgcgaagagatcgccgccgcactc
aagagcgcgccgctcgaagaactgaagctgcaggcgtcggcgcgcgattcgcgcgacttc
gtcggcgcgctgcgcggcaagcatgcggccggacacgccgccgtcatcgccgaggtgaag
aaggcgagcccgtcgaaaggcgtgctgcgcgagcgcttcgtgccggccgacatcgcccgc
tcgtacgcggagcacggcgccgcatgcctgtcggtgctgaccgacgagcagttcttccag
ggcagcgcgcgctatctggaagaggcgcgcgccgcatgcaacctgcccgtgctgcgcaag
gacttcatcgtcgacccgtatcaggtgctcgaagcgcgcgcgatgggcgcggacgcgatc
ctgctgatcgccgccgcactcgatacgccgctgatggtcgatctcgaggcgtacgcgcat
tcgctcgggctcgcggtgctcgtcgaggtgcacaaccgcgacgaactgagcgcggcgctc
gaactgaagacgccgctcgtcggcatcaacaaccgcaacctgcgcacgttcgagacgacg
atcgacacgacgctcggcatgctcgacgcgattccggacgaccgcatcgtcgtcaccgaa
tcgggcatcctgtcgcgcgcggacgtcgagcgaatggaagcggcgggcgtgcatacgttc
ctcgtcggcgaagcgttcatgcgcgccgagaatccgggcgcggaactcgcgcggatgttc
ttctga

DBGET integrated database retrieval system