KEGG   Burkholderia thailandensis E264: BTH_I2993Help
Entry
BTH_I2993         CDS       T00311                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00340  Histidine metabolism
bte01100  Metabolic pathways
bte01110  Biosynthesis of secondary metabolites
bte01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BTH_I2993 (hisD)
Enzymes [BR:bte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BTH_I2993 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Rieske
Motif
Other DBs
NCBI-ProteinID: ABC38104
UniProt: Q2SUA2
Position
I:complement(3432599..3433936)
Genome map
AA seq 445 aa AA seqDB search
MAIKIRKLDSASAGFAAELRAVLAFEASEDDAIERSVAQILADVKARGDAAVLEYTNRFD
RLNAASVAALELPQDALEAALEGLEPKRRAALEAAAARVRGYHEKQKIECGSHSWQYTEA
DGTVLGQKVTPLDRVGLYVPGGKAAYPSSVLMNAIPARVAGVGEIVMVVPTPDGVKNDLV
LAAALLGGVDRVFTIGGAQAVAALAYGTKTVPAVDKICGPGNAYVASAKRRVFGTVGIDM
IAGPSEILVLCDGTTDPSWVAMDLFSQAEHDELAQSILLCPDDAFIERVEKAIDELLPTM
PRQDVIRASLEGRGALVKVRDMAEACKIANDIAPEHLEISALEPHQWGKQIRHAGAIFLG
RYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFFKRSSLIEVSAEGAHTLGEIASELA
YGEGLQAHAKSAEYRMKGAGDRQKG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggctatcaagatacgcaaactcgattcggcaagcgcaggcttcgcggccgaattgcgt
gcggtgctcgcgttcgaggcgagcgaagacgacgcgatcgagcgctcggtcgcgcagatc
ctcgccgatgtgaaggcgcgcggcgacgccgcggtgctcgagtacacgaatcgcttcgac
cggctgaacgcggcaagcgtcgcggcgctcgagctgccgcaggacgcgctggaggcggcg
ctcgagggcctcgagccgaagcgccgcgcggcgctggaggcggcggccgcgcgcgtgcgc
ggctaccacgagaagcagaagatcgagtgcggcagccatagctggcagtacacggaagcc
gacggcaccgtgctcggccagaaggtgacgccgctcgaccgcgtcgggctgtacgtgccg
ggcggcaaggcggcgtatccgtcgtcggtgctgatgaacgcgattccggcgcgcgtcgcg
ggcgtcggcgagatcgtgatggtcgtgccgacgccggacggcgtgaagaacgatctcgtg
ctcgccgcggcgcttctgggcggtgtcgaccgcgtgttcacgatcggcggcgcgcaggcg
gtcgccgcgctcgcgtacggtacgaaaacggtgcccgccgtcgacaagatctgcgggccg
ggcaacgcgtacgtcgcgtcggccaagcgccgcgtgttcggcacggtcggcatcgacatg
atcgccgggccgtccgagatcctcgtgctgtgcgacggcacgaccgatccgtcgtgggtc
gcgatggacctgttctcgcaggccgagcacgacgagctcgcgcaatcgatcctgctgtgc
ccggacgacgcgttcatcgagcgcgtcgagaaggcgatcgacgagctgctgccgacgatg
ccgcgccaggacgtgattcgcgcgtcgctcgaggggcgcggcgcgctcgtcaaggtgcgc
gacatggccgaggcgtgcaagatcgcgaacgacatcgcgcccgagcatctcgagatatcc
gcgctcgagccgcaccaatggggcaagcagatccgccacgcgggcgcgatcttcctcggc
cgctacacgagcgaaagcctgggcgattactgcgcgggcccgaatcacgtgctgccgacg
tcgcgcaccgcgcgcttctcgtcgccgctcggcgtgtacgatttcttcaagcgctcgagc
ctgatcgaggtgagcgccgaaggcgcgcacacgctcggcgagatcgcgtccgagctcgcg
tacggcgaaggattgcaggcgcacgcgaagagcgccgagtatcggatgaaaggggcgggc
gaccgccagaagggttaa

DBGET integrated database retrieval system