KEGG   Burkholderia thailandensis E264: BTH_II0016Help
Entry
BTH_II0016        CDS       T00311                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
bte  Burkholderia thailandensis E264
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:bte00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:14702..15325
Genome map
AA seq 207 aa AA seqDB search
MLKVLGKAPSINVRKVLWTCAELELAFEREDWGAGFRSTQTPEFLALNPNGLVPVLVDGD
FVLWESNAILRYLANRYGGAHLYPVEPHARARVDQWLDWQTSALNRAWSYAFLALVRNAP
DHRDPAQIRASCESWAQHMAILNAQLDATGAFVAGADYTLADVAIGLSINRWLRTPFYKP
DFPAVSAYFDRLAVRPGFAEHCFNGLP
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagtgcttggcaaggcgccgtcgatcaacgtccgcaaggtgctgtggacgtgc
gccgaattggagcttgcattcgagcgcgaagactggggggcgggattccggtcgacgcag
acgcctgaatttctcgcgctgaacccaaacggcctcgtgccggtgctcgtggatggcgat
ttcgtgctctgggagtcgaacgcgatcctgcgctatctggcgaaccggtacggcggcgcg
catctgtatccggtcgagccgcacgcgcgggcgcgcgtcgaccaatggctcgactggcag
acgagcgcgttgaatcgcgcgtggagctacgcgttcctcgcgctcgtacgcaatgccccg
gatcatcgcgacccggctcagatccgcgcgtcgtgcgaaagctgggcgcagcacatggcg
attctgaacgcgcaactcgacgcgacgggcgcgttcgtcgccggcgcggactacacgctc
gccgacgtcgcgattggcctgtcgatcaaccgctggttgcgcacgccgttctacaagccc
gattttccggcggtgtccgcgtatttcgaccggctcgccgttcggccgggttttgccgag
cattgcttcaacggcttgccgtga

DBGET integrated database retrieval system