KEGG   Burkholderia thailandensis E264: BTH_II0141Help
Entry
BTH_II0141        CDS       T00311                                 

Definition
two-component system sensor protein
Orthology
K07677  
two-component system, NarL family, capsular synthesis sensor histidine kinase RcsC [EC:2.7.13.3]
Organism
bte  Burkholderia thailandensis E264
Pathway
Two-component system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bte02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(170006..172864)
Genome map
AA seq 952 aa AA seqDB search
MSNARSEFLIQQSKLTIKLQVRRTALMRAVMHAEGLWNRRIEPSPELLSRFDAHQGYAVL
HTPQGAPAALALGIPAPGRSASTFAPYLALLETQLLMGDGQSPLPDDRVEGYSFSPDGTY
LSLLWSREDQAPEAFIESHSASGVIGDAMRGIRYLRDASTIIPLRADRRTVWLPPHPDPL
TGKPMIRVVQPAIDAAGKLFAIYVRSLPLDMFYSNLNDTPAGGTLTIVDRKGRVIIGSWN
PPGRDGDVTDSALSIRSLGDGFDGLVERHENGMFVTSDQLPGTDWVLVHAYSWKTIAAAL
ALRFSLMTGFAAGIIVMLWVLAIQFDRKGLIPNYRRAQRLLESEVLNRAILRTAPVGLGL
LSAHDGSVLLQNNAMLELSARTSGEPLPNRLWDAYRQTTGRSNDEDGALLLHDLAIERED
SNPIYLQANVVAARYRGANVLLCTLLDISMRKESELKLKEARIASDQANKAKSTFLATMS
HEIRTPLNAIIGNLELLRRSQLSNQQSERLQVVESCSNALLHIINDILDLSKVESGQMTL
ENIPFDIQALLQEIVDAYAPLAESKGLQLLSNLGEGVARYYSGDPARIRQILSNLIGNAI
KFTERGHISVDVHQAKAAQGDSAIEIWVNDTGIGIRPDRIATLFDVYTQADTSIHRRFGG
SGLGLPLCKRLATIMGGSIEVDSLPDFGTTVTVVLPLREARHATAMSSGPAVRRRDAPAH
ARPSLHVLVAEDHPANRALLRDQLEALDHRVDVVENGRDALRAFGEHQYDVVLTDLGMPE
LDGFGFAMFANKMRASIPIVAMTAHATAEDYRRSKKVGIAEIVLKPLSLTTLEKVLQRHA
ARTLAAEVVVADAGEAHAESRIRTLPPAVAAALRTATLQSIDKIAHALASRRFETIRQEL
HSIKGGFALTGNRFLIARCSAAEELAEREDLDTLRAAWRNLESSLLEALERL
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaacgcgcgctccgaatttcttattcagcagtctaaacttacaatcaaattacaa
gttcggcgcacggcgctcatgcgggccgtgatgcatgccgaaggcctgtggaacaggcgc
atcgaaccgtcgccggagttgctttcgcgattcgacgcacatcagggctatgccgtcctg
cacacgccccagggcgcgccggctgcgctcgccctcggcatcccggcgccaggccgctcc
gcgagcacgttcgcgccgtatctcgcgctcctggaaacgcaactcctgatgggagacggc
caatcgccgttgccggacgatcgggtggaaggctactcgttctcgcccgacggcacgtac
ctgtcgcttctatggtcccgcgaagaccaggccccggaagcattcatcgaatctcattcg
gcatccggagtgatcggcgatgcgatgcgcggcatccgctatcttcgcgacgccagcacc
atcattccgctgcgtgcggatcgacgaaccgtatggctgccgccgcatcccgatccgctc
accggcaagcccatgatccgcgtcgttcagcccgccatcgacgcggcgggaaaattgttc
gcaatctatgtccgcagcctgccgctcgacatgttttacagcaatctgaacgacacgccc
gccggcggcacgctcacgattgtcgatcgcaaaggccgcgtcatcataggttcgtggaac
ccgcccggccgggacggcgacgtaacggattccgcgttgagcatccgatcgctcggcgac
ggattcgacggcctcgtcgaacgtcacgaaaacggcatgttcgtgaccagcgatcagttg
cctggaaccgactgggtgctcgtccacgcctattcgtggaagacgatcgcggcggcattg
gcgctgcgcttctccctcatgacggggttcgcggccggcatcatcgtcatgctgtgggtc
ttggcgatccagttcgaccgtaaaggcctcattccgaactatcgccgcgcccagcggctg
ctggaaagcgaagtgctcaatcgcgcgatcctgcgcaccgcgcccgtagggctcggcctg
ctttccgcacacgacggcagcgtgctgctgcagaacaatgcaatgctcgaactgtcggcg
cgcacgagcggcgaaccgctgcccaaccggctctgggacgcatatcggcagacgaccggc
cggtcgaacgacgaagacggcgcgctgctgctgcacgatctcgccatcgagcgtgaagac
tccaatccgatctacctgcaagccaacgtggtcgccgcccgttatcgcggcgcgaacgtc
ctgctctgcacgctgctggacatctccatgcgcaaggaaagcgagctgaagctgaaggaa
gcgcgcatcgcctccgatcaggcgaacaaggccaaatccacgttcctcgccacgatgagc
cacgaaatcagaacccccctcaacgcgatcatcggcaatctggaattgctgcgcaggtcg
cagttgtccaaccagcaaagcgaacgcctgcaagtggtggaatcgtgctcgaacgccttg
ctgcacatcatcaacgacatactcgatctttccaaggtcgaatccggccagatgacgctc
gagaacatcccattcgatatccaggcgctattgcaggagatcgtcgacgcctatgcgccg
ctcgccgaatcgaagggtctgcagctcctttcgaatctcggggagggggtagcgagatac
tactccggtgatccggcgcgcatccgccagatactgtcgaatttgatcgggaatgcaatc
aaattcacggaaaggggccatatttcagtcgacgtccatcaggcaaaggccgcccaaggc
gattccgcgatagaaatctgggtcaacgataccggcatcggaatacggccggaccgcatc
gcgaccttgttcgatgtttatacgcaagccgacacctcgatccatcgccgcttcggcggt
tccggtctcggattgccgctctgcaaacggcttgcaacgatcatgggcggctcgatcgaa
gtcgacagcctgcccgatttcggcaccacggtcaccgttgtgctgccgctgcgagaagcc
cgccatgcgacggccatgtcgagcgggccggccgtgcggcggcgcgatgcaccggcgcac
gcccgcccgtcgctgcacgtgctcgtcgcggaggatcacccggccaaccgcgcgctattg
cgcgaccaactcgaggcgctcgatcatcgggtggatgtcgtcgaaaacggacgcgacgcg
ctgcgcgcattcggcgaacatcaatacgacgtcgtgttgaccgacctcggcatgcccgag
ctcgacggatttggattcgcgatgttcgccaacaagatgcgcgccagcatcccgatcgtc
gcgatgaccgcccatgcgaccgccgaagactatcggcgatccaagaaagtcggcatcgcc
gagatcgtcctgaagccgctttcgctgaccacactggagaaagtgctgcaacgtcacgcg
gcgcgcacgctcgcggcggaagtcgtcgtcgccgacgccggcgaggctcacgccgaatcc
cggatacgcaccctgccgcctgccgtcgcggccgcgttgcgcacagcgacgttgcagtcg
atcgacaagatcgctcatgcgcttgcgtcacgccgcttcgaaacgatccggcaggaactt
cactcgataaaagggggattcgcgctgacgggcaaccgcttcctcatcgcgcgttgctcc
gccgccgaggaattggcagaacgcgaggatctggatacgttgcgcgcagcctggcgaaac
ctggagtcttcgctcctcgaagcgctggagcgcctgtag

DBGET integrated database retrieval system