KEGG   Burkholderia thailandensis E264: BTH_II0213Help
Entry
BTH_II0213        CDS       T00311                                 

Definition
glucan 1,3-alpha-glucosidase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
bte  Burkholderia thailandensis E264
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BTH_II0213
Enzymes [BR:bte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BTH_II0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(253045..255690)
Genome map
AA seq 881 aa AA seqDB search
MSAKHLGFKQAVLVGSLAALACAAFLPAHASAAEAFGSPGATAVRGPSAKSFLGTAVNGA
SRVYFTGYRGILSEVYYPVLDTPESVDLQFLVGDAGKTFVDEEKQQAYSAVQTDTRTMSW
QVTTSNGSHNWQIRKIIFADPNYNAIVQRVTFTALNGHKVGDFNLYLLSKPYLDNAGGGN
AAQTVSGSGGTALVANHNSRYSALVTSRPWKVVNGVGMTSNGFVGQSDGWTDLLGGTADK
TMDWTFSSATNGNVAQTGWIDLGDPSATSVSFDVVLGFGGTQDQALGDANTVLGGDLAGE
QQQYDTAWHNYAAGLSSQNGAADDGYYLAAMTLKTMQDKSNGAMIAGIGTPWGETQGDAN
AGGYHLVWPRDLFKFANALTTAGDTSSATSVVNYLFNTLQQTTNCGIAEYNASGCAQGYS
RIGRFPQNAWVNGWPYWQGTQMDEQAMPIILAWRLGPSVFNPLWPKIKLTADYIVNTGPW
TYQERWEENAGYSPSTIAAEIAGLVTAADIATQNGDTASAARYLSAADYWQENVAAWTYT
SSGTFGNGSYYIRINPAGRSGTGTDRASFAPTAGPDTPQTLTVKNGGGSHDARRVVDGGF
FELVRMGVKRATDPTIVNTISVYDSVLGQTLSLANAPALSPNAWFRYNFDGYGEHNDGSD
FDGTGAGRLWPIFTAERGMVEIARQGNGNAGSAYFSTLKQLTTPEGFLPEQVWSNSTTLP
DGWAVTTPAGYTPGQPTKSMAPLNWAMGEYISLLASIQAGRIVDVPSVVCARYSNCVAPP
QSGQVPVAVNVNASTQLGQQMYVTGNVAALGNWNTDLGIPVDPANYPVWSNTVNLPAAQA
IQYKYYRKNADGSVTWENGSGNRQLQTPASGTLTLNDQVSW
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaaagcacttaggtttcaaacaggcggtgctggttggcagtctggccgcgctc
gcgtgcgcggcgttcttgcccgcgcatgcttcggctgccgaagcattcggctcgcccggc
gcaacggccgtgcgaggcccctcggccaagtcgttcctcggcacggcggtcaacggcgca
tcgcgggtctatttcaccggttatcggggcatcctgtccgaggtctactatccggttctc
gatacgccggagtccgtcgacctgcagttcctggtcggcgatgccggcaagaccttcgtc
gacgaagaaaagcagcaggcctactcggccgtgcaaacggacacgcgcacgatgagctgg
caagtgacgaccagcaacggttcgcataactggcaaatccgcaagatcatcttcgccgat
ccgaactacaacgcgatcgtgcaacgcgtcacgttcaccgcgctcaacggccacaaggtc
ggcgatttcaatctttacctgctgtccaagccgtacctcgacaacgccggcggcggcaac
gccgcgcaaacggtgtccggcagcggcggcaccgcgctcgtcgcgaatcacaacagccgc
tattcggcgctcgtcacgagccgcccgtggaaagtggtcaacggcgtcggcatgacgtcg
aacggcttcgtcgggcagagcgacggctggaccgacctgctcggcggcaccgccgacaag
acgatggactggacgttctcgtccgcgaccaacggcaacgtcgcgcagacgggctggatc
gatctcggcgacccgagcgcgacgagcgtgtcgttcgacgtcgtgctcggcttcggcggc
acgcaggaccaggcgctcggcgacgcgaacaccgtgctcggcggcgatctcgccggcgag
cagcagcagtacgacaccgcatggcacaactatgcggcgggcctgtcgtcgcagaacggc
gccgcggatgacggctactatctggccgcgatgacgctcaagacgatgcaggacaagagc
aacggcgcgatgatcgccggcatcggcacgccgtggggcgaaacgcagggcgatgcgaac
gcgggcggctatcacctcgtgtggccgcgcgacctgttcaagttcgcgaacgcgctgacg
acggccggcgacacgtcgagcgcgacgagcgtcgtcaactatctgttcaacacgctgcag
cagacgacgaactgcggcatcgccgaatacaacgcgtccggctgcgcgcagggctacagc
cgcatcgggcgcttcccgcagaacgcgtgggtgaacggctggccgtactggcaaggcacg
cagatggacgagcaggcgatgccgatcatcctcgcgtggcggctcggcccgagcgtgttc
aatccgttgtggccgaagatcaagctcaccgccgattacatcgtcaacaccggcccgtgg
acgtatcaggagcgctgggaggaaaacgccggctactcgccgtcgacgatcgcggccgag
atcgcgggcctcgtcacggcggcggacatcgcgacgcaaaacggcgacacggcgagcgcc
gcgcgctacctctccgcggccgactactggcaggagaacgtcgcggcgtggacgtacacg
tcgagcggcacgttcggcaacggcagctactacatccggatcaatccggcgggccgctcg
ggcaccggcaccgaccgcgcgagcttcgcgccgaccgccggccccgacacgccgcagacg
ctgaccgtgaagaacggcggcggcagccacgatgcgcggcgcgtcgtcgacggcggcttc
ttcgagctcgtccggatgggcgtcaagcgcgcgaccgatccgacgatcgtcaacacgatc
tcggtctacgacagcgtgctcggccagacgctgagtctcgcgaacgcgccggcgctgtcg
ccgaacgcgtggttccgctacaacttcgacggctacggcgagcacaatgacggcagcgac
ttcgacggcaccggcgcgggccgcctgtggccgatcttcaccgccgagcgcgggatggtc
gagatcgcgcgccagggtaacggcaacgcgggcagcgcgtacttctcgacgctcaagcaa
ctgacgacgcccgagggcttcctgccggaacaggtatggtcgaattcgacgacgctgccc
gacggctgggcggtgacgacgcccgccggctacacgccggggcagccgaccaaatcgatg
gcgccgctcaactgggcgatgggcgagtacatcagcctgctcgcgtcgatccaggcgggg
cgcatcgtcgacgtgccgtcggtagtctgcgcgcgctacagcaactgcgtcgcgccgccg
caaagcgggcaggtgccggtggccgtcaacgtgaacgcgagcacgcagctcggccagcag
atgtacgtgacgggcaacgtcgccgcgctcggcaactggaacaccgatctcggcattccg
gtcgatccggccaactacccggtgtggagcaacaccgtcaacctgccggccgctcaggcg
atccagtacaagtactaccggaagaacgcggacggcagcgtgacgtgggagaacgggtcc
ggcaaccgccagcttcagacgcccgcgagcggcacgctgacgctgaacgatcaggtgagc
tggtga

DBGET integrated database retrieval system