KEGG   Burkholderia thailandensis E264: BTH_II0232Help
Entry
BTH_II0232        CDS       T00311                                 

Gene name
asnB-1
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bte  Burkholderia thailandensis E264
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bte00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:281105..282973
Genome map
AA seq 622 aa AA seqDB search
MCGITGWIDFSRDLRNEAPIVGTMTDTLARRGPDARGVWLDTHAALGHRRLSIIDLERGA
QPMLTPERGPRGLPRAVISYAGETYNFRELRAELGALGHRFDTHCDTEVVLRAYLEWGAA
FVDRLNGMYSIAIWDTARDELLLVRDRLGVKPLFYYPTADGVIFGSEPKAILAHPDVRAR
TSSEGLCDALLFLRTPGQVPFSGMREVKPGHLLRVRRGGLVEERYWALEARPHTDDLPTT
IATIRALLDDIVSRQMISDVPLCALLSGGVDSSTVAALAQKQRRANGGGALATFCVDFTG
HTRNFRADPIRPTADAPFALEVARHIGSDHHTIELDQAGLLDPQVRETVLRAWDLPFNFA
DLDVSLYRLFAEVRQHASVALSGEAADEIFGGYLWFSDPVARRAQTFPWLKLGAHRGLDP
RALFHRAFIDELKLGEYEAQLYRAALAEVPRLDGESAEDRRTRELHYLTLTRWLPVLLDK
KDRMGMASGLEGRVPFCDHRLVEYVFNIPWSMKTFSGQEKALLRAAAADLLPDSVLSRKK
AAYPSIQTPGYDRGLIERLNRAIAAGRAPLEPFIDAGALRNLTAKTATGSLSEFERILLE
SSSRLNDWLDLYRVELDGVPAG
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcaccggatggatcgatttctcccgcgatctgcgcaacgaagcgccgatc
gtcggcacgatgaccgatacgctcgcgcgccgcgggcccgatgcgcgcggcgtgtggctc
gacacgcacgccgcgctggggcaccggcggctgtcgatcatcgatctcgagcgcggcgcg
cagccgatgctcacgcccgagcgcgggccgcgcggcttgccgcgcgcggtcatctcgtat
gcgggcgagacctacaacttccgtgaactgcgggccgagctgggcgcgctcggccaccgg
ttcgacacgcactgcgacaccgaggtcgtgctgcgcgcgtatctcgaatggggcgcggcg
ttcgtcgatcgcctcaacgggatgtactcgatcgcgatctgggacacggcgcgcgacgag
ttgctgctcgtgcgcgaccggctcggcgtgaagccgctgttctattatccgacggcggac
ggcgtgatcttcggctccgagccgaaggcgatcctcgcgcatccggacgtgcgcgcgcgc
acgtcgtcggaggggttgtgcgacgcgctgctgttcctgcgcacgccggggcaggtgccg
ttctccgggatgcgcgaggtgaaacccggccatctgctgcgcgtgcggcgcggcggcctc
gtcgaggaacgctattgggcgctcgaagcgcgcccgcacacggacgacttgccgacgacg
atcgcgacgatccgcgcgttgctcgacgacatcgtgtcgcgccagatgatctccgacgtg
ccgctgtgcgcgctgctgtcgggcggcgtcgattcgagcaccgtcgccgcgctcgcgcag
aagcagcggcgcgcgaacggcggcggcgcgctggcgacgttctgcgtcgatttcaccggc
cacacgcggaacttccgcgccgatccgatccggcccaccgccgatgcgccgttcgcgctg
gaagtcgctcggcacatcggcagcgaccatcacacgatcgagctggaccaggcggggctg
ctcgatcctcaggtacgcgaaacggtgctgcgcgcgtgggacttgccgttcaacttcgcc
gatctcgacgtttcgctgtaccgcctgttcgccgaggtccgccagcatgcgagcgtcgcg
ctgtccggcgaggcggccgacgagatcttcggcggctacctgtggttctccgatcccgtc
gcgcgccgcgcgcagacctttccgtggctcaagctgggcgcgcatcgcgggctcgatccg
cgcgcgctgtttcaccgggctttcatcgacgagctgaaactcggcgaatacgaagcgcag
ctctatcgcgcggcgctcgccgaggtgccgcgtctcgacggcgagagcgcggaggaccgc
cgcacgcgcgagctgcactatctgacgctcacgcgctggctgccggtgctgctcgacaag
aaagaccggatggggatggcgagcggcctggaaggacgcgtgccgttttgcgatcaccgg
ctcgtcgagtacgtgttcaacatcccgtggtcgatgaagacgttcagcggccaggagaag
gcgttgctgcgcgcggcggcggccgacctgctgcccgattcggtgctgagccgcaaaaag
gccgcgtatccgtcgattcagacgccgggctacgaccgcggcctgatcgagcggctgaat
cgcgcgatcgcggccggccgcgcgccgctcgagcctttcatcgacgccggcgcgttgcgc
aacctgaccgcgaagaccgccaccggcagcctttcggaattcgaacgaatcctgctggag
tcgagcagccggctcaacgactggctcgacctctatcgtgtcgagctcgacggcgtgccg
gcgggctga

DBGET integrated database retrieval system