KEGG   Burkholderia thailandensis E264: BTH_II0281Help
Entry
BTH_II0281        CDS       T00311                                 

Definition
JamB
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bte  Burkholderia thailandensis E264
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bte01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bte01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(345236..346270)
Genome map
AA seq 344 aa AA seqDB search
MSSGQPPSTNEGASQPEGAIGSAIPASFPSGSHGFARPTTVSPRSAVRLDRRIAAVVTLL
PALGTAAAIALWIGGHGPGAAEWIVFAIFYFATALGLEVGFHRHVTHKAFKAKPWVRAAL
IALGSMGAHGPVNWWASTHRRHHSTSDGCGDPHSPHLSGDGIGGRLKGLYHSHMGWLFVG
ESTRPAGWEKYVPDLYQDPLVFRQHMAYYRWVAIGLVLPPFVCGLASRSWMGVLLGFLWG
DMARIFAVSHCIWALNSLCHVIGRRDFHTTAHDRSRNSLLLAIPTFGQGWHNNHHAFPAS
AFTGLHWWQIDPGGLFVRVLERLHLVYDVHRPNAELIEKKRIAP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagttccggccagcctccgtccacgaacgaaggtgcgagccagcccgagggtgcgatc
ggaagcgcgattcccgcgtcttttccttccggttcgcatggcttcgctcgcccgacaacg
gtttcgccccgctccgccgtccgtctcgatcgccgcatcgccgccgtcgtcacgctgctt
cccgcgttgggcacggccgccgcgatcgcgctgtggatcggcggtcacgggccgggcgcc
gccgaatggatcgtgttcgcgatcttctatttcgcgaccgcgctcgggctcgaagtcggc
tttcatcgccacgtgacgcacaaggcgttcaaggcgaagccgtgggtgcgcgccgcgctg
atcgcgctcggctcgatgggcgcgcacggtcccgtcaactggtgggcgtccacgcaccgc
cgccatcattcgacgagcgacggctgcggcgatccgcattcgccgcacctgtcgggcgac
ggcatcggcggccggctcaagggcctctatcacagccacatggggtggctgttcgtcggc
gaatcgacacgcccggcgggctgggagaagtacgtgcccgacctctatcaggacccgctc
gtgttccggcagcacatggcgtactaccgctgggtcgcgatcgggctcgtgctgccgccg
ttcgtctgcgggctcgcgtcgcgctcgtggatgggcgtgctgctcggcttcctgtggggc
gacatggcgcgcatcttcgcggtcagccactgtatctgggcgctgaactcgctgtgccac
gtgatcggccggcgcgacttccacacgaccgcgcacgaccgcagccgcaacagcctgctg
ctcgcgatcccgacgttcgggcagggctggcacaacaatcatcacgcgttccccgcgtcc
gcgttcaccgggctgcactggtggcagatcgatccgggcgggctgttcgtgcgcgtgctg
gaacgcctgcacctcgtctacgacgtgcatcgcccgaacgcggaactcatcgaaaagaag
cgcatcgcaccatga

DBGET integrated database retrieval system