KEGG   Burkholderia thailandensis E264: BTH_II0412Help
Entry
BTH_II0412        CDS       T00311                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
bte  Burkholderia thailandensis E264
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BTH_II0412
Enzymes [BR:bte01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     BTH_II0412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
Position
II:496691..498112
Genome map
AA seq 473 aa AA seqDB search
MFSRDVARPRGAFVASNAVECNRVVENQPLMQTMTFLPQEFIRKVRDREPFDAADVARFV
RGVTTGDVTEGQIAAFAMAVYFNELPLSARIALTLAQRDSGDVLDWRGERLNGPVVDKHS
TGGVGDLTSLLIGPMVAACGGHVPMISGRGLGHTGGTLDKLEAIPGYDVAPRVDTLRRVV
RDAGVAIVGQTAQLAPADKRIYAVRDVTATVESISLITASILSKKLAAGVDALAMDVKVG
SGAFMPTAEKSAELARSIVEVGNGAGMKTAAMLTDMNQALAPCAGNAIEVRCAIDFLTGA
ARPERLGAVSFALAGQMLTMSGLAEDAGDARRRLRAALESGAAAERFARMVAALGGPADL
IERPDRHLPRAAVAVPVGAGRAGRIERIDARALGLAVVGLGGGRAKIGDALDHSVGLSAL
AELGERVEAGQPLATVHARDADAAALAADAVRRAYRIGAEPPAGTRVVYAVIE
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
ttgttctcgcgggatgtcgcccggccgcgcggcgccttcgtcgcctcgaatgctgtcgaa
tgcaatcgtgtcgttgaaaatcaaccgcttatgcaaaccatgaccttcctgccgcaggaa
ttcattcgcaaggtgcgcgaccgcgagccgttcgacgcggccgatgtcgcgcgtttcgtg
cgcggcgtgacgacgggcgacgtgaccgaaggccagatcgccgcgttcgcgatggccgtc
tacttcaacgagctgccgctgtccgcgcggatcgcgctgacgctcgcgcagcgcgattcc
ggcgacgtgctcgactggcgcggcgagcgtctgaacggccctgtcgtcgacaagcattcg
actggcggcgtcggcgatctgacctcgctgctgatcgggccgatggtcgccgcgtgcggc
ggccacgtgccgatgatctcgggccgcggcctcggccatacgggcggcacgctcgacaag
ctcgaggcgattcccggctacgatgtcgcgcctcgcgtcgatacgctgcgccgcgtcgtg
cgcgacgcgggcgtcgcgatcgtcggccagaccgcacagctcgcgcctgccgacaagcgg
atctacgcggtgcgcgacgtgacggcgaccgtcgagtcgatctcgctgatcaccgcgtcg
atcctgtcgaagaagctcgcggcgggcgtcgacgcgctcgcgatggacgtgaaggtcggc
tccggcgcgttcatgccgaccgcggagaaatcggccgagctcgcgcgcagcatcgtcgag
gtcggcaacggcgccggaatgaagacggccgcgatgctcaccgacatgaatcaggcgctc
gcgccgtgcgcgggcaatgcgatcgaggtgcgctgcgcgatcgatttcctgacgggcgcg
gcgcgccccgagcggctcggagcggtcagtttcgcgctcgccgggcaaatgctgacgatg
agcgggcttgccgaggacgcgggcgatgcgcgccgccggctgcgcgccgcgctcgaatcg
ggcgcggccgccgagcgtttcgcgcggatggtcgcggcgctcggcgggcccgccgatctg
atcgagcggccggaccggcacctgccgcgcgcggcggttgccgtgcccgtgggcgccggg
cgcgccggccggatcgagcggatcgacgcgcgcgcgctcggcctcgcggtcgtcggcctg
ggcggcgggcgcgcgaagatcggcgatgcgctcgaccactcggtcgggttgtccgcgctc
gcggagctgggcgagcgcgtggaggcgggccagccgctcgcgaccgttcacgcacgcgat
gccgacgcggccgcgctggccgccgatgcggtgcggcgcgcgtaccgcatcggcgcggag
ccgccggcgggaacgcgcgtcgtttacgcggtgatcgaatga

DBGET integrated database retrieval system