KEGG   Burkholderia thailandensis E264: BTH_II0412Help
Entry
BTH_II0412        CDS       T00311                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
bte  Burkholderia thailandensis E264
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BTH_II0412 (deoA)
Enzymes [BR:bte01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     BTH_II0412 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
Position
II:496790..498112
Genome map
AA seq 440 aa AA seqDB search
MTFLPQEFIRKVRDREPFDAADVARFVRGVTTGDVTEGQIAAFAMAVYFNELPLSARIAL
TLAQRDSGDVLDWRGERLNGPVVDKHSTGGVGDLTSLLIGPMVAACGGHVPMISGRGLGH
TGGTLDKLEAIPGYDVAPRVDTLRRVVRDAGVAIVGQTAQLAPADKRIYAVRDVTATVES
ISLITASILSKKLAAGVDALAMDVKVGSGAFMPTAEKSAELARSIVEVGNGAGMKTAAML
TDMNQALAPCAGNAIEVRCAIDFLTGAARPERLGAVSFALAGQMLTMSGLAEDAGDARRR
LRAALESGAAAERFARMVAALGGPADLIERPDRHLPRAAVAVPVGAGRAGRIERIDARAL
GLAVVGLGGGRAKIGDALDHSVGLSALAELGERVEAGQPLATVHARDADAAALAADAVRR
AYRIGAEPPAGTRVVYAVIE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcctgccgcaggaattcattcgcaaggtgcgcgaccgcgagccgttcgacgcg
gccgatgtcgcgcgtttcgtgcgcggcgtgacgacgggcgacgtgaccgaaggccagatc
gccgcgttcgcgatggccgtctacttcaacgagctgccgctgtccgcgcggatcgcgctg
acgctcgcgcagcgcgattccggcgacgtgctcgactggcgcggcgagcgtctgaacggc
cctgtcgtcgacaagcattcgactggcggcgtcggcgatctgacctcgctgctgatcggg
ccgatggtcgccgcgtgcggcggccacgtgccgatgatctcgggccgcggcctcggccat
acgggcggcacgctcgacaagctcgaggcgattcccggctacgatgtcgcgcctcgcgtc
gatacgctgcgccgcgtcgtgcgcgacgcgggcgtcgcgatcgtcggccagaccgcacag
ctcgcgcctgccgacaagcggatctacgcggtgcgcgacgtgacggcgaccgtcgagtcg
atctcgctgatcaccgcgtcgatcctgtcgaagaagctcgcggcgggcgtcgacgcgctc
gcgatggacgtgaaggtcggctccggcgcgttcatgccgaccgcggagaaatcggccgag
ctcgcgcgcagcatcgtcgaggtcggcaacggcgccggaatgaagacggccgcgatgctc
accgacatgaatcaggcgctcgcgccgtgcgcgggcaatgcgatcgaggtgcgctgcgcg
atcgatttcctgacgggcgcggcgcgccccgagcggctcggagcggtcagtttcgcgctc
gccgggcaaatgctgacgatgagcgggcttgccgaggacgcgggcgatgcgcgccgccgg
ctgcgcgccgcgctcgaatcgggcgcggccgccgagcgtttcgcgcggatggtcgcggcg
ctcggcgggcccgccgatctgatcgagcggccggaccggcacctgccgcgcgcggcggtt
gccgtgcccgtgggcgccgggcgcgccggccggatcgagcggatcgacgcgcgcgcgctc
ggcctcgcggtcgtcggcctgggcggcgggcgcgcgaagatcggcgatgcgctcgaccac
tcggtcgggttgtccgcgctcgcggagctgggcgagcgcgtggaggcgggccagccgctc
gcgaccgttcacgcacgcgatgccgacgcggccgcgctggccgccgatgcggtgcggcgc
gcgtaccgcatcggcgcggagccgccggcgggaacgcgcgtcgtttacgcggtgatcgaa
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system