KEGG   Burkholderia thailandensis E264: BTH_II0415Help
Entry
BTH_II0415        CDS       T00311                                 

Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bte  Burkholderia thailandensis E264
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BTH_II0415
   01230 Biosynthesis of amino acids
    BTH_II0415
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTH_II0415
   00030 Pentose phosphate pathway
    BTH_II0415
   00051 Fructose and mannose metabolism
    BTH_II0415
   00052 Galactose metabolism
    BTH_II0415
  Energy metabolism
   00680 Methane metabolism
    BTH_II0415
Enzymes [BR:bte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BTH_II0415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:499887..500939
Genome map
AA seq 350 aa AA seqDB search
MPKRTARHRIDRAPCGVRSRVAASGRHVFFLLPRSPEMPEIVTITPNPAVDVATAVERVT
DTRKLRCGPARRDPGGGGINVARVLTRLGADCSAVYLAGGGTGLALHRLLADEGVRARCV
DIAGETRENFSVLETSTGREFRFVLPGPALAPHEWPRCVDALARLADASRYLVMSGSLPP
GMPDDCYGRLVRIARARGVRTAVDTSGPALAAALDAGVYLVKPSLGELRALTGLPLEDDG
ARLAAARAIVGSGRAQIVALTLGDAGALVVSRDDAVRLPGVKVAVRSAIGAGDSFVAGLV
AALDRGAGIADASRYALATASASLLSEGTALCTKEDVERIYRELPGMAGA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaagcggactgcccgacaccggatcgaccgtgcgccttgcggcgtgcggtcgcgc
gtcgccgcatcaggccgtcacgttttctttctgttgccacgatcgcccgagatgcccgaa
atcgtcaccatcacgccgaatcccgctgtcgacgtcgcgacggccgtcgagcgcgtcacc
gacacccgcaagctgcgctgcggccccgcgcggcgcgatccgggcggcggcgggatcaac
gtcgcgcgcgtgctgacgcgcctcggcgccgattgctcggccgtctatctcgcgggcggc
ggcaccgggctcgcgctgcaccgcctgctcgccgacgaaggcgtgcgcgcgcgctgcgtc
gacatcgccggcgagacgcgcgagaatttctcggtgctcgaaacgtcgacggggcgcgaa
ttccgctttgtgctgccggggcccgcgctcgcgccgcacgaatggccgcgctgcgtcgac
gcgctcgcgcggctcgccgacgcgtcgcgctatctggtgatgagcggcagcctgccgccc
gggatgccggacgattgctatggccggctcgtgcggatcgcgcgcgcgcgcggcgtgcgc
acggccgtcgacacgtcggggccggcgctcgcggccgcgctcgacgccggcgtctatctg
gtgaagccgagcctgggcgaattgcgtgcgctgaccgggctgccgctcgaagacgacggc
gcgcgcctcgcggcggcgcgcgcgatcgtcggcagcgggcgcgcgcagatcgtcgcgctg
acgctcggcgacgccggcgcgcttgtcgtgtcgcgcgacgatgcggtgcggttgccgggc
gtgaaggtcgcggtgcgcagcgcgatcggcgcgggcgacagtttcgtcgcggggctcgtc
gccgcgctcgatcgcggcgcgggcatcgccgatgcgtcgcgctacgcgctcgccaccgcg
tcggcgtcgctgctgagcgagggcaccgcgctgtgcacgaaggaagacgtcgagcggatc
tatcgcgaactgccggggatggccggcgcgtga

DBGET integrated database retrieval system