KEGG   Burkholderia thailandensis E264: BTH_II0428Help
Entry
BTH_II0428        CDS       T00311                                 

Definition
zinc-containing alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bte  Burkholderia thailandensis E264
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BTH_II0428
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTH_II0428
  Lipid metabolism
   00071 Fatty acid degradation
    BTH_II0428
  Amino acid metabolism
   00350 Tyrosine metabolism
    BTH_II0428
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BTH_II0428
   00626 Naphthalene degradation
    BTH_II0428
Enzymes [BR:bte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BTH_II0428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:513183..514208
Genome map
AA seq 341 aa AA seqDB search
MAQYMKAAVVHAFGEPLRIEEVPVPTPGPGQILVNIKASGVCHTDLHAADGDWPVKPTLP
FIPGHEGVGFVTAVGGGVKHVKEGDRVGVPWLYTACGHCEYCQTGWETLCHEQQNTGYSV
NGSYAEYVLADPNYVGHLPSNVAFDEIAPILCAGVTVYKGIRVTDTRPGQWIAISGIGGL
GHVAVQYAKAMGLHVVAVDVAHEKLELARKLGAAFVVDASRDDPAAVIQKEIGGVHGVLV
TAVSRSAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
DFAAEGLVRAHIHRDKLENINSVFTALREGKVDGRIVLTGE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaatacatgaaggccgcggtggtacacgcattcggcgaaccgcttcgcatcgag
gaagtcccagtgccgacgcctggcccgggccagatcctcgtgaacatcaaggcgtcgggc
gtgtgccataccgatctgcacgcggccgacggcgactggcccgtcaagccgacgctgccg
ttcattccggggcacgagggcgtcggcttcgtgacggcggtgggcggcggcgtcaagcac
gtgaaagagggcgatcgcgtcggcgtgccgtggctctacaccgcatgcggccattgcgag
tattgccagaccggctgggaaacgctgtgccacgagcagcagaacaccggctattcggtg
aacggcagttatgcggaatacgtgctcgccgatccgaactacgtcggccatctgccgagc
aacgtcgcgttcgacgaaatcgcgccgatcctgtgcgcgggcgtgaccgtctacaagggc
attcgcgtgaccgatacgcgccccggccaatggatcgcgatctcggggatcggcgggctc
gggcacgtcgcggtccagtacgcgaaggcgatggggctgcacgtcgtcgcggtcgacgtc
gcgcacgagaagctcgagcttgcgcgcaagctgggtgcggcgttcgtcgtcgacgcgtcg
agggacgatcccgccgcggtgatccagaaggagatcggcggcgtgcacggcgtgctcgtg
acggccgtgtcgcgcagcgcgttcgcgcaggcgctcggcatggtgcggcgaggcgggacg
gtatcgttgaacgggctgccgccgggggattttccgctgccgattttctcgacggtgctc
aacgggatcacggtgcgcggctcgatcgtcggcacgcggcgcgatcttcaggagtcgctc
gacttcgcggccgaagggctcgtgcgcgcgcatatccatcgcgacaagctggagaacatc
aatagcgtgttcacggcgctgcgcgaagggaaggtcgacgggcggatcgtgttgaccggg
gagtga

DBGET integrated database retrieval system