KEGG   Burkholderia thailandensis E264: BTH_II0428Help
Entry
BTH_II0428        CDS       T00311                                 

Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00010  Glycolysis / Gluconeogenesis
bte00071  Fatty acid degradation
bte00350  Tyrosine metabolism
bte00625  Chloroalkane and chloroalkene degradation
bte00626  Naphthalene degradation
bte01100  Metabolic pathways
bte01110  Biosynthesis of secondary metabolites
bte01120  Microbial metabolism in diverse environments
bte01130  Biosynthesis of antibiotics
bte01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTH_II0428
  Lipid metabolism
   00071 Fatty acid degradation
    BTH_II0428
  Amino acid metabolism
   00350 Tyrosine metabolism
    BTH_II0428
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BTH_II0428
   00626 Naphthalene degradation
    BTH_II0428
Enzymes [BR:bte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BTH_II0428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABC34589
UniProt: Q2T871
Position
II:513183..514208
Genome map
AA seq 341 aa AA seqDB search
MAQYMKAAVVHAFGEPLRIEEVPVPTPGPGQILVNIKASGVCHTDLHAADGDWPVKPTLP
FIPGHEGVGFVTAVGGGVKHVKEGDRVGVPWLYTACGHCEYCQTGWETLCHEQQNTGYSV
NGSYAEYVLADPNYVGHLPSNVAFDEIAPILCAGVTVYKGIRVTDTRPGQWIAISGIGGL
GHVAVQYAKAMGLHVVAVDVAHEKLELARKLGAAFVVDASRDDPAAVIQKEIGGVHGVLV
TAVSRSAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
DFAAEGLVRAHIHRDKLENINSVFTALREGKVDGRIVLTGE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaatacatgaaggccgcggtggtacacgcattcggcgaaccgcttcgcatcgag
gaagtcccagtgccgacgcctggcccgggccagatcctcgtgaacatcaaggcgtcgggc
gtgtgccataccgatctgcacgcggccgacggcgactggcccgtcaagccgacgctgccg
ttcattccggggcacgagggcgtcggcttcgtgacggcggtgggcggcggcgtcaagcac
gtgaaagagggcgatcgcgtcggcgtgccgtggctctacaccgcatgcggccattgcgag
tattgccagaccggctgggaaacgctgtgccacgagcagcagaacaccggctattcggtg
aacggcagttatgcggaatacgtgctcgccgatccgaactacgtcggccatctgccgagc
aacgtcgcgttcgacgaaatcgcgccgatcctgtgcgcgggcgtgaccgtctacaagggc
attcgcgtgaccgatacgcgccccggccaatggatcgcgatctcggggatcggcgggctc
gggcacgtcgcggtccagtacgcgaaggcgatggggctgcacgtcgtcgcggtcgacgtc
gcgcacgagaagctcgagcttgcgcgcaagctgggtgcggcgttcgtcgtcgacgcgtcg
agggacgatcccgccgcggtgatccagaaggagatcggcggcgtgcacggcgtgctcgtg
acggccgtgtcgcgcagcgcgttcgcgcaggcgctcggcatggtgcggcgaggcgggacg
gtatcgttgaacgggctgccgccgggggattttccgctgccgattttctcgacggtgctc
aacgggatcacggtgcgcggctcgatcgtcggcacgcggcgcgatcttcaggagtcgctc
gacttcgcggccgaagggctcgtgcgcgcgcatatccatcgcgacaagctggagaacatc
aatagcgtgttcacggcgctgcgcgaagggaaggtcgacgggcggatcgtgttgaccggg
gagtga

DBGET integrated database retrieval system