KEGG   Burkholderia thailandensis E264: BTH_II0459Help
Entry
BTH_II0459        CDS       T00311                                 

Definition
zinc-containing alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bte  Burkholderia thailandensis E264
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BTH_II0459
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTH_II0459
  Lipid metabolism
   00071 Fatty acid degradation
    BTH_II0459
  Amino acid metabolism
   00350 Tyrosine metabolism
    BTH_II0459
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BTH_II0459
   00626 Naphthalene degradation
    BTH_II0459
Enzymes [BR:bte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BTH_II0459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:546165..547151
Genome map
AA seq 328 aa AA seqDB search
MRAMVFDGGAPRLREAELPDPVPGAGQLLIDVHACGVCRTDLHVVDGDLRDPKRPVIPGH
EIVGTVAALGAGAEGFAIGERVGVPWLGHTCGHCAYCASGRENLCDAPGFTGYTIDGGYA
QRTVADARFCVHVPSRYDDIHAAPLLCAGLIGYRTLKMAGAARRIGLYGFGAAAHLVAQG
ARFQGRTVYAFTRAGDAAAQQLARRLGAAWAGGSDEAAPEPLDAALIFASVGALVPAALA
AVVKGGIVVCGGIHMSDIPSFSYDLLWGERRIVSVANLTRDDAAEFMRIANDVQLDVEAT
PYPLAQANQALDDLRAGRLTGAAVLTMR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgatggtcttcgacggcggcgcgccgcggctgcgcgaagccgagttgccggac
cccgtgccgggggcggggcaactgttgatcgacgtgcacgcgtgcggcgtgtgccggacc
gatctgcacgtcgtcgacggcgatctgcgcgatccgaagcggcccgtgatcccggggcac
gagatcgtcggcacggtcgccgcgctcggcgcgggcgcggagggcttcgcgatcggcgag
cgcgtcggcgtgccgtggctcggccacacgtgcggccactgcgcgtactgcgcgagcggc
cgcgagaacctgtgcgacgcgcccggcttcaccggctacacgatcgacggcggctacgcg
cagcgcacggtcgccgacgcacgcttctgcgtgcacgtgccgagccgctacgacgacatc
catgcggccccgctgctgtgcgcgggcctcatcggctaccggacgctgaagatggcgggc
gccgcgcgccgcatcggcctgtacggattcggcgcggccgcgcacctcgtcgcgcagggc
gcgcgctttcaggggcgcaccgtctacgcgttcacgcgagcgggcgacgccgccgcgcag
cagctcgcgcgccggctcggcgccgcatgggcgggcggcagcgacgaagccgcgcccgag
ccgctcgacgcggcgctgatcttcgcgtccgtcggcgcgctcgtgccggccgcgctcgcg
gcggtcgtgaagggcggcatcgtcgtgtgcggcgggattcacatgtcggacatcccgtcg
ttttcgtacgacttgttgtggggggagcggcggatcgtgtcggtcgcgaacctgacgcgc
gacgacgcagcggaattcatgcgaattgcgaacgacgttcaactcgacgtggaggccacg
ccgtatccgctcgcgcaggcgaaccaggcgctcgacgatctgcgtgccgggcgtctgacg
ggcgcggcggtgctgacgatgcgctga

DBGET integrated database retrieval system