KEGG   Burkholderia thailandensis E264: BTH_II0569Help
Entry
BTH_II0569        CDS       T00311                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bte  Burkholderia thailandensis E264
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BTH_II0569 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BTH_II0569 (mhpF)
   00650 Butanoate metabolism
    BTH_II0569 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BTH_II0569 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BTH_II0569 (mhpF)
   00622 Xylene degradation
    BTH_II0569 (mhpF)
   00621 Dioxin degradation
    BTH_II0569 (mhpF)
Enzymes [BR:bte01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BTH_II0569 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:671879..672772
Genome map
AA seq 297 aa AA seqDB search
MKNKSSRTRVAILGSGSIGLDLMFKVKASEHFDLKFVVGRHANSDGLKLARSCNVETSSD
GLDFLKENEDAYDLVFDATSAAAHKVNNGFFSGAGKFVIDLTPAKLGRLCVPCINLDDIG
AEQNVNLITCGGQASLPLAYALKQAVDEIEYLEVVSAIASRSAGIATRENIDEYMTTTEY
ALAQFSGAKKTKAILNINPAEPGVRMQTTLYAHARYRDFDRVRACVAEMVEKVREYVPGY
RLVVEPIESQGRITISLTVRGRGDYLPEYAGNLDIINCAALAVASHRHATARLGATQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaagtcatcgcgcacgcgcgtggcgattctcggatcgggcagcatcgggctc
gacctgatgttcaaggtcaaggcatccgagcacttcgatctgaagttcgtcgtcggacgc
catgcaaacagcgacgggctgaagctcgcgcgcagctgcaacgtcgagacgtcgagcgac
ggcctcgatttcctgaaggaaaacgaagatgcgtacgacctggtgttcgacgcgacgtcg
gccgccgcacacaaggtcaacaacggcttcttctccggtgcgggcaagttcgtgatcgat
ctgacgcccgcgaagctcggccgcctgtgcgtgccgtgcatcaatctggacgacatcggc
gccgagcagaacgtgaacctgatcacctgcggcgggcaggcgagcctgccgctcgcgtac
gcgctgaaacaggcggtcgacgagatcgaatacctggaggtggtgtcggcgatcgcgtcg
cgcagcgccggcatcgcgacgcgcgagaacatcgacgaatacatgacgacgaccgagtac
gcgctcgcgcagttcagcggtgcgaagaagacgaaggcgatcctcaacatcaatccggcc
gagcccggcgtgcggatgcagacgacgctctatgcacacgcgcgctaccgcgatttcgac
cgcgtgcgcgcgtgcgttgccgagatggtcgagaaggttcgcgaatacgtgcccggctat
cggctcgtcgtcgagccgatcgagagccaggggcggatcacgatcagcctgaccgtgcgc
gggcgcggcgactatttgcccgagtacgcgggcaacctggacatcatcaattgcgcggcg
ctcgcggtcgcctcgcatcggcacgcaaccgccagactaggagccacacaatga

DBGET integrated database retrieval system