KEGG   Burkholderia thailandensis E264: BTH_II0649Help
Entry
BTH_II0649        CDS       T00311                                 

Definition
tyrosinase (EC:1.14.18.1)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
bte  Burkholderia thailandensis E264
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    BTH_II0649
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BTH_II0649
Enzymes [BR:bte01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     BTH_II0649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:759043..760650
Genome map
AA seq 535 aa AA seqDB search
MSNVNAPRVRRSVRDLQKRYDNGEKKPLEDLVRAWVGIQALPPSDPKSFFALGGYHGEPF
QYRKPVDALPQDDIYPYWGGYCNHGNVLFPTWHRMYVYKLEEALQSIVPGVSMPFWDETD
EYTLKHGIPSILTQEKFELDGKQIDNPLRSFVLPVALSDRLPGDGNIYEKPKGYVTVRYP
LSGLVGTPEALEQTKIHNAKFPLPEKNTELLNSNVRAWLKGDSPTPGDPDPTRNGVYAKY
VRCLSAPNYTVFSNTTSASVWNSSNPGLVTPVESPHNDIHLAVGGFDYGGDEIGQIAGAN
GDMGENNTAGMDPIFFFHHCNVDRMFWVWQKQTGHTDRLDIIRNYPGTNASDSQGPTPGF
APGESLNLTTPLNPFKKASGEAYTSEDCINIERQLGFTYGPGSLDDATPELKSLLAVPSG
NSTKKLTVTGIDRAQIQGSFIMKAYASVTDANGKTREYYLGHKSILSRWNVVQCANCLTH
LDIVAHFPLSAMPADDVPKAKFRVEFIHRGGGVPSAAKAAIDKVSALQPKFEVSD
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgtcaatgcacccagagtgcgccggtcggtgcgcgatcttcagaagcggtac
gacaacggagagaagaagccgctcgaggatctcgtgcgcgcgtgggttggcatccaggca
ttgccgccgtcggatccgaaatcgttcttcgcgctcggcggttatcacggcgagccgttt
cagtatcgcaagccggtcgacgcgctgccgcaggacgacatctatccgtactggggcggt
tactgcaaccacggcaacgtgctgttcccgacctggcaccggatgtacgtctacaagctc
gaggaagcgctgcagagcatcgtgccgggcgtatcgatgccgttctgggacgaaaccgac
gagtacacgctcaagcacggcattccgtcgatcctgactcaggagaagttcgagctggac
ggcaagcagatcgacaatccgctgcgctcgttcgtgctgcccgttgcgctgtcggatcgc
ctgccgggcgacggcaacatctacgagaagccgaaggggtacgtcacggtgcgctatccg
ctgtcgggcctcgtcggaacgccggaagcgctcgagcagacgaagatacacaacgcgaag
tttccgctgccggagaagaacaccgaactgctgaacagcaacgtgagggcatggctgaag
ggcgattcgccgacgccgggcgatcccgatccgacccgcaacggcgtctacgcgaaatac
gtccgctgcctgtccgcgccgaactacacggtgttttccaacacgacatccgcatcggtg
tggaacagctcgaacccggggctcgtcacgcccgtcgaatcgcctcacaacgatatccac
ctggccgtcggcggcttcgattacggcggcgacgagatcgggcagatcgccggcgcgaac
ggcgacatgggcgagaacaacacggccggcatggacccgatcttcttcttccatcattgc
aacgtcgatcgcatgttctgggtctggcagaagcagacgggccacaccgatcgtctcgac
atcatccgcaactatccgggcacgaacgcgagcgattcgcagggcccgacacccggtttc
gcgccgggcgaatcgctcaatctgacgacgccgctcaatccgttcaagaaggcgagcggc
gaagcgtacacgtccgaggactgcatcaatatcgagcggcagctcggattcacgtatggc
ccgggctcgctcgacgacgccacgcccgaactgaagtcgctgctcgccgtgccgagcgga
aacagcacgaagaagctgacggtgacgggcatcgatcgggcgcagatccaggggtcgttc
atcatgaaggcgtacgcgagcgtgacggatgcgaacggcaagacgcgcgagtattacctc
gggcacaagtcgatcctgagccgctggaacgtcgtgcagtgcgcgaattgcctcacgcac
ctggatatcgtcgcgcatttcccgctgagcgcgatgccggccgacgacgtgccgaaggcg
aaattccgggtggagttcatccatcgcggcggcggcgtgccgagcgcggcgaaggcggcc
atcgacaaggtgtccgcgctgcaaccgaagttcgaggtgagcgactga

DBGET integrated database retrieval system