KEGG   Burkholderia thailandensis E264: BTH_II0661Help
Entry
BTH_II0661        CDS       T00311                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00020  Citrate cycle (TCA cycle)
bte00190  Oxidative phosphorylation
bte00650  Butanoate metabolism
bte01100  Metabolic pathways
bte01110  Biosynthesis of secondary metabolites
bte01120  Microbial metabolism in diverse environments
bte01130  Biosynthesis of antibiotics
bte01200  Carbon metabolism
Module
bte_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bte_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bte_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BTH_II0661
   00650 Butanoate metabolism
    BTH_II0661
  Energy metabolism
   00190 Oxidative phosphorylation
    BTH_II0661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABC34433
UniProt: Q2T7I9
Position
II:773518..773886
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRVTASVMAIYTVILLVWFFTARDFSYEGWASIFA
TQWMKLATFVTLLSLFYHAWVGVRDIWMDYVKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgaataaccgtatcggctcgaagcgcctcgtcgtcggcgctcactatggcctg
cgcgactggctcgcgcagcgtgtcaccgccagcgtgatggcgatctacaccgtcatcctg
ctcgtctggttcttcaccgcgcgcgatttctcgtacgagggctgggcgtcgatcttcgcg
acgcaatggatgaagctcgcgaccttcgtcacgctgctttcgctcttctaccacgcatgg
gtcggcgtgcgcgacatctggatggactacgtcaagcccgtcggcgtgcgcctgctgctg
caatcgctgacgatcgtctggctgctcgcgtgcgcgggctacgctgcgcagattctctgg
agagtttaa

DBGET integrated database retrieval system