KEGG   Burkholderia thailandensis E264: BTH_II0679Help
Entry
BTH_II0679        CDS       T00311                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bte  Burkholderia thailandensis E264
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BTH_II0679 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BTH_II0679 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BTH_II0679 (trpB)
Enzymes [BR:bte01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BTH_II0679 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
UniProt: 
Position
II:795104..796297
Genome map
AA seq 397 aa AA seqDB search
MYNLPDDRGHFGPYGGVFVAETLIHALDELRAAYEKFKHDPDFVAEYDRELKHFVGRPSP
IYHAQRWSETLGGAQIYLKREDLNHTGAHKINNVIGQALLAKRMGKKRVIAETGAGQHGV
ATATICARFGMECVVYMGAEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNIENTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDDASVQLIGVEAAGDGLDTGHHAASLIAGSPGVLHGNRTYLLQDENGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVGITDEEALKAFHDCCRIEGIIPALESSHAIAY
GVKLAPTLPKDKILLVNLSGRGDKDMHTVAERSGIAL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaccttcccgatgatcgcggccatttcggcccatatggcggcgtgttcgtcgcc
gaaacgctgattcacgcgctcgacgagctgcgcgccgcgtacgagaaattcaagcacgac
cccgacttcgtcgccgagtacgaccgcgagctgaagcacttcgtcggccgtccgtcgccg
atttaccacgcgcagcgctggagcgagacgctcggcggcgcgcagatctacctgaagcgc
gaagacctgaaccacaccggcgcgcacaagatcaacaacgtgatcggtcaggcgctgctc
gcgaagcggatgggcaagaagcgcgtgatcgccgagacgggcgcgggccagcacggcgtc
gcgaccgcgacgatctgcgcgcgcttcgggatggagtgcgtcgtctacatgggcgccgag
gacgtgcgccggcaggccgcgaacgtctaccggatgaagctgctcggcgcgaccgtcgtg
cccgtcgaatcgggctcgcgcacgctgaaggacgcgctgaacgaggcgatgcgcgactgg
gtcacgaacatcgagaacacgttctacatcatcggcacggtggcgggcccgcacccgtat
ccgatgatggtgcgcgacttccagcgcgtgatcggcgacgaatgcaaggtgcagatgcct
gagctcgccggccggcagccggacgcggtgatcgcttgcgtcggcggcggctcgaacgcg
atgggcatcttctatccgtacatcgacgacgcatcggtgcaactgatcggcgtagaggcg
gcgggcgacgggctcgacaccggccatcacgcggcgtcgctgatcgccggcagcccgggc
gtgctgcacggcaatcgcacgtacctgctgcaggacgagaacggccagatcatcgagacg
cattcggtgtcggcgggcctcgactatccgggcgtgggccccgagcatgcgtggttgaag
gacagcggccgcgcgcagtacgtcggcattaccgacgaagaggcgctgaaggcgtttcac
gactgctgccggatcgaggggatcatcccggcgctcgaatcgagccacgcgatcgcgtac
ggcgtgaagctcgcgccgacgctgccgaaggacaagatcctgctcgtcaacctgtcgggg
cgcggcgacaaggacatgcacacggtcgccgagcgatcgggcatcgcgctctga

DBGET integrated database retrieval system