KEGG   Burkholderia thailandensis E264: BTH_II0699Help
Entry
BTH_II0699        CDS       T00311                                 

Gene name
galU-3
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bte  Burkholderia thailandensis E264
Pathway
bte00040  Pentose and glucuronate interconversions
bte00052  Galactose metabolism
bte00500  Starch and sucrose metabolism
bte00520  Amino sugar and nucleotide sugar metabolism
bte01100  Metabolic pathways
bte01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BTH_II0699 (galU-3)
   00052 Galactose metabolism
    BTH_II0699 (galU-3)
   00500 Starch and sucrose metabolism
    BTH_II0699 (galU-3)
   00520 Amino sugar and nucleotide sugar metabolism
    BTH_II0699 (galU-3)
Enzymes [BR:bte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BTH_II0699 (galU-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: ABC35790
UniProt: Q2T7F1
Position
II:817564..818448
Genome map
AA seq 294 aa AA seqDB search
MKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRSK
RAIEDHFDKSFEIESELEARGKEKLLELVRGIKPSHVDCFYVRQPAALGLGHAVLCAEKL
VHGEPFAVILADDLLHGDQPVLKQLVDVFNHYHSSVIGVETIERDDSRSYGVVEGREWEE
DIIKLSGIIEKPAPEHAPSNLGVVGRYVLMPSIFEHLRKIKPGAGGELQLTDAVQSLLTE
EQVLAYRYYGTRFDCGSKLGYLKATIELALQHPEVGREFEAYLRNCLPALAAVA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagtcaccaaagccgtgttccccgttgccggtctcggcacacggtttttgcccgcc
accaaggcgagtccgaaggaaatgctgcccgtcgtcgacaagccgctgatccagtatgcg
gtcgaagaggcgatcaatgcgggcatcaccgagatgatcttcgtgacgggccgcagcaag
cgcgcgatcgaagatcacttcgacaaatcgttcgagatcgaatccgagctcgaggcgcgc
ggcaaggaaaagctgctcgagctcgtgcgcggcatcaagccgagccacgtcgactgcttc
tacgtgcgccagccggccgcgctcggcctgggccacgcggtgctctgcgcggagaagctc
gtgcacggcgagccgttcgcggtgatcctcgccgacgacttgctgcacggcgaccagccg
gtgctcaagcagctcgtcgacgtcttcaatcactatcacagctcggtgatcggcgtcgag
acgatcgagcgcgatgacagccgctcgtacggcgtcgtcgagggccgcgagtgggaagag
gacatcatcaagctgtcgggcatcatcgagaagccggcgcccgagcatgcgccttcgaat
ctcggcgtcgtcggccgctacgtgctgatgccgagcatcttcgagcatctgcgcaagatc
aagccgggcgcgggcggcgagctgcaactgacggacgcggtgcagtcgctgctgaccgag
gagcaggtgctcgcataccgatactacggcacccgcttcgattgcggcagcaagctcggc
tatctgaaggcgacgatcgagctcgcgctgcagcatccggaagtcggccgcgaattcgag
gcatacctgcgcaactgcctgccggcgctcgccgcggtcgcttag

DBGET integrated database retrieval system