KEGG   Burkholderia thailandensis E264: BTH_II0784Help
Entry
BTH_II0784        CDS       T00311                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bte  Burkholderia thailandensis E264
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bte00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(913547..914500)
Genome map
AA seq 317 aa AA seqDB search
MSDQFFQPQSGNAMPRFAGIATMMRLPHASSAAALDACFVGVPFDLGTSNRTGARFGPRQ
IRSESVLLRPYNMATRAAPFDSLRVADVGDIATNPYNLADSIARIETAYDEILAHGCRPV
TLGGDHTITLPILRAMHRRHGRVGLIHVDAHADVNDTMFGEKIAHGTPFRRAVEEGLLDC
SRVVQIGLRGTGYAAEDFDWCRDQGFRVVQAEACWNRSLAPLMDEVRARVQGGPVYLSFD
IDGIDPAYAPGTGTPEIAGLTVPQGLEIVRGAWGLDIVGADLVEVAPPYDPFGTTALVGA
NLAYEMLCVLPGVRRRA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaccagttcttccagccgcaaagcggcaacgcgatgccccgcttcgcgggcatc
gcgacgatgatgcggctgccgcacgcgtcgagcgccgcggcgctcgacgcgtgcttcgtc
ggcgtgccgttcgatctcggcacgtcgaaccggacgggcgcgcgcttcggcccgcgccag
atccgcagcgaatcggtgctgctgcgcccgtacaacatggcgacgcgcgcggcgccgttc
gattcgctgcgcgtcgccgatgtcggcgatatcgcgacgaacccgtacaacctcgccgat
tcgatcgcgcggatcgaaaccgcgtacgacgaaatcctcgcgcacggctgccgcccggtc
acgctcggcggcgaccacacgatcacactgccgatcctgcgcgcgatgcatcgcaggcac
gggcgcgtcggactcatccacgtcgacgcgcacgcggacgtgaacgacacgatgttcggc
gagaagatcgcgcacggcacgccgtttcgccgcgcggtagaggaaggcctgctcgactgc
tcccgcgtcgtgcagatcgggctgcgcggcaccggctacgcggccgaggatttcgactgg
tgccgcgaccagggttttcgcgtcgtccaggccgaggcgtgctggaaccgttcgctcgcg
ccgctgatggacgaagtgcgcgcgcgcgtgcaaggcggccccgtctacctgagcttcgac
atcgacggcatcgatcccgcgtacgcaccgggcacgggcacgccggagatcgccggcctc
acggtgccgcagggcctcgagatcgtgcgcggcgcgtgggggctcgacatcgtcggcgcc
gatctcgtcgaggtcgcgccgccgtacgatccgttcggcaccaccgcgctcgtcggcgcg
aatctcgcttacgagatgctctgcgtgctgcccggcgtgaggcggcgcgcgtaa

DBGET integrated database retrieval system