KEGG   Burkholderia thailandensis E264: BTH_II0792Help
Entry
BTH_II0792        CDS       T00311                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bte  Burkholderia thailandensis E264
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bte00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:923402..924883
Genome map
AA seq 493 aa AA seqDB search
MARRAGRDAGERREMHEMHEMHEMHEMHEMRGAEDARERRQARACAPARRSSCGRRMRWR
VIARAVAASVAVAAFAAASAGLACATERTRGDGARRDAGLRDAAAGVGETSAPLSESMST
SPAQAVPRASADIAACSPSWPRWERFKRDFVSADGRVIDVGSPDERTVSEGQAYGLFFAL
VANDRPAFDALLRWTEDNLAQGDLAARLPAWLWGRAADGAWRVLDANAASDADLWLAYAL
LEAGRLWGERSYTARGALLAKRVLDDETATLPGLGLVLLPGPTGFRPARDAWRLNPSYSP
PQAIRGIGAHLPDDARWARLAASAGRVLIDSAPRGFAPDWVLYRANDGFRPDADTRAASA
YNAIRVYLWAGMLDARDPLAIPLTARFAPFADYVAAHGAPPETVDTMTGAAGSRDGNAGF
SAAAVPFLEARGERALADAQVARIARLERETPSGYYANVLTLFGLGWRDGRYRFAADGTL
RVRWSEPCSMPAR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgacgggcggggcgcgacgcgggtgagaggcgcgagatgcacgaaatgcacgag
atgcacgagatgcacgagatgcacgagatgcgcggcgcggaggatgcgcgggagaggcgg
caggcgcgggcatgcgcgcccgcgcgccgatcgtcgtgcgggcggcggatgcgttggcgc
gtgatcgcgcgcgccgtggcggcgagcgtcgcggttgccgcgttcgcggcggcgtcggca
ggcctcgcctgcgcgacggagcgcacacgaggcgacggcgcgcggcgcgacgccggattg
cgcgacgcggcggcgggggtgggcgagacatcggcgccgttgtcggaatcgatgtcgaca
tcgccggcgcaggcggtcccccgcgcatccgccgacatcgccgcctgctcgccatcgtgg
ccgcgctgggagcgcttcaagcgcgatttcgtgtcggccgacggccgcgtgatcgacgtc
ggctcgcccgatgagcggaccgtgtcggaggggcaggcgtacggcctgttcttcgcgctc
gtcgcgaacgaccggccggcgttcgacgcgctgctgcgctggaccgaggacaacctcgcg
cagggcgacctggccgcgcgtctgccggcgtggctgtgggggcgcgcggccgacggcgct
tggcgcgtgctcgacgcgaacgccgcgtccgacgcggatctgtggctcgcgtacgcgctg
ctcgaagccggccggctgtggggcgagcgcagctacaccgcgcgcggcgcgctgctcgca
aagcgcgtgctcgacgacgaaaccgcgacgctgccggggctcggcctcgtgctgctgccg
ggcccgacgggcttccggccggcgcgcgacgcgtggcggctgaacccgagctattcgccg
ccgcaggcgattcgcgggatcggcgcgcatctgcccgacgacgcgcgctgggcgcggctc
gcggcgagcgccggccgcgtgctgatcgacagcgcgccgcgcggcttcgcgccggactgg
gtgctgtaccgcgcgaacgacggcttccggccggacgccgacacgcgcgcggcgagcgcg
tacaacgcgattcgcgtctatttgtgggcggggatgctcgatgcgcgcgatccgctcgcg
ataccgttgacggcgcgtttcgcaccgttcgccgactacgtcgccgcacacggcgcaccg
ccggaaacggtcgacacgatgacgggcgcggccggttctcgcgacggcaacgccgggttt
tccgcggcggcggtgccgtttctcgaggcgcgcggcgagcgcgcgctcgccgacgcgcag
gtcgcgcgcatcgcgcggctcgaacgcgagacgccgagcggctactacgcgaacgtgctg
acgctgttcgggctcggatggcgcgacgggcgttaccggttcgcggccgacggcacgctg
cgggtccgatggagcgagccgtgctcgatgcccgcgcgttga

DBGET integrated database retrieval system