KEGG   Burkholderia thailandensis E264: BTH_II0792Help
Entry
BTH_II0792        CDS       T00311                                 

Definition
(GenBank) endo-1,4-D-glucanase
  KO
K20542  endoglucanase [EC:3.2.1.4]
Organism
bte  Burkholderia thailandensis E264
Brite
Enzymes [BR:bte01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BTH_II0792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_8
Motif
Other DBs
NCBI-ProteinID: ABC35458
UniProt: Q2T760
Position
II:923402..924883
Genome map
AA seq 493 aa AA seqDB search
MARRAGRDAGERREMHEMHEMHEMHEMHEMRGAEDARERRQARACAPARRSSCGRRMRWR
VIARAVAASVAVAAFAAASAGLACATERTRGDGARRDAGLRDAAAGVGETSAPLSESMST
SPAQAVPRASADIAACSPSWPRWERFKRDFVSADGRVIDVGSPDERTVSEGQAYGLFFAL
VANDRPAFDALLRWTEDNLAQGDLAARLPAWLWGRAADGAWRVLDANAASDADLWLAYAL
LEAGRLWGERSYTARGALLAKRVLDDETATLPGLGLVLLPGPTGFRPARDAWRLNPSYSP
PQAIRGIGAHLPDDARWARLAASAGRVLIDSAPRGFAPDWVLYRANDGFRPDADTRAASA
YNAIRVYLWAGMLDARDPLAIPLTARFAPFADYVAAHGAPPETVDTMTGAAGSRDGNAGF
SAAAVPFLEARGERALADAQVARIARLERETPSGYYANVLTLFGLGWRDGRYRFAADGTL
RVRWSEPCSMPAR
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgacgggcggggcgcgacgcgggtgagaggcgcgagatgcacgaaatgcacgag
atgcacgagatgcacgagatgcacgagatgcgcggcgcggaggatgcgcgggagaggcgg
caggcgcgggcatgcgcgcccgcgcgccgatcgtcgtgcgggcggcggatgcgttggcgc
gtgatcgcgcgcgccgtggcggcgagcgtcgcggttgccgcgttcgcggcggcgtcggca
ggcctcgcctgcgcgacggagcgcacacgaggcgacggcgcgcggcgcgacgccggattg
cgcgacgcggcggcgggggtgggcgagacatcggcgccgttgtcggaatcgatgtcgaca
tcgccggcgcaggcggtcccccgcgcatccgccgacatcgccgcctgctcgccatcgtgg
ccgcgctgggagcgcttcaagcgcgatttcgtgtcggccgacggccgcgtgatcgacgtc
ggctcgcccgatgagcggaccgtgtcggaggggcaggcgtacggcctgttcttcgcgctc
gtcgcgaacgaccggccggcgttcgacgcgctgctgcgctggaccgaggacaacctcgcg
cagggcgacctggccgcgcgtctgccggcgtggctgtgggggcgcgcggccgacggcgct
tggcgcgtgctcgacgcgaacgccgcgtccgacgcggatctgtggctcgcgtacgcgctg
ctcgaagccggccggctgtggggcgagcgcagctacaccgcgcgcggcgcgctgctcgca
aagcgcgtgctcgacgacgaaaccgcgacgctgccggggctcggcctcgtgctgctgccg
ggcccgacgggcttccggccggcgcgcgacgcgtggcggctgaacccgagctattcgccg
ccgcaggcgattcgcgggatcggcgcgcatctgcccgacgacgcgcgctgggcgcggctc
gcggcgagcgccggccgcgtgctgatcgacagcgcgccgcgcggcttcgcgccggactgg
gtgctgtaccgcgcgaacgacggcttccggccggacgccgacacgcgcgcggcgagcgcg
tacaacgcgattcgcgtctatttgtgggcggggatgctcgatgcgcgcgatccgctcgcg
ataccgttgacggcgcgtttcgcaccgttcgccgactacgtcgccgcacacggcgcaccg
ccggaaacggtcgacacgatgacgggcgcggccggttctcgcgacggcaacgccgggttt
tccgcggcggcggtgccgtttctcgaggcgcgcggcgagcgcgcgctcgccgacgcgcag
gtcgcgcgcatcgcgcggctcgaacgcgagacgccgagcggctactacgcgaacgtgctg
acgctgttcgggctcggatggcgcgacgggcgttaccggttcgcggccgacggcacgctg
cgggtccgatggagcgagccgtgctcgatgcccgcgcgttga

DBGET integrated database retrieval system