KEGG   Burkholderia thailandensis E264: BTH_II0907Help
Entry
BTH_II0907        CDS       T00311                                 

Gene name
pfkB
Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
bte  Burkholderia thailandensis E264
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BTH_II0907 (pfkB)
Enzymes [BR:bte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     BTH_II0907 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:1064419..1065468
Genome map
AA seq 349 aa AA seqDB search
MTTVVTVTPNPALDQTVRVRNLTLGDVNRAESLEFNAGGKGVNVAGCLADYGIATIATGL
LGADDGAAFDAMFADKQIADRFVRIAGRTRINVKLVDDARGETTDINLATSRPAAADVAA
LERRIAELAAPGRWFVLAGSLPPGVDASFYRRATRALHDAGARVALDTSGAPLADALAAA
DPRELPDLAKPNLAELEAALGRALAGDDAIVRAACELAARGIARVVVSLGAQGALGVAAD
FGADFGADVGANAVAPRPIAYRVFRATPPRVPVASTVGAGDAFVAGLVASLTEARAWGDT
GRRATAFAAAKLARVGPHLPDRATLAALAAQVEVDTFTLAAEADGAVHS
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgtcgtgaccgtgacgccgaatccggcgctcgaccagaccgtgcgcgtgcgc
aatttgacgctcggcgacgtgaaccgcgcggaatcgctcgagttcaacgcgggcggcaag
ggcgtgaacgtcgccgggtgcctcgccgactacgggatcgcgacgatcgcgaccgggctg
ctcggcgcggacgacggcgcggcgttcgacgcgatgttcgccgacaagcagatcgcggac
cgcttcgtgcggatcgcggggcgcacgcggatcaacgtgaagcttgtcgacgacgcgcgc
ggcgagacgaccgacatcaatctcgcgacgtcgcggccggcggcggccgacgtcgccgcg
ctcgagcgccggatcgccgagctcgccgcgcccggccgctggttcgtgctcgcgggcagc
ctgccgccgggcgtcgacgcgtcgttctaccggcgcgcgacgcgcgcgctgcacgatgcg
ggcgcgcgcgtcgcgctcgacacgagcggcgcgccgctcgccgacgcgctcgcggccgcc
gatccgcgcgagctgccggacctcgcgaagccgaatctcgcggaactcgaggcggcgctc
ggccgcgcgctcgccggcgacgacgcgatcgtgcgcgccgcgtgcgaactggccgcgcgg
gggatcgcgcgcgtcgtcgtgtcgctcggcgcgcagggcgcgctcggcgtggcggcggat
ttcggcgcggatttcggcgcggatgtcggcgcaaatgccgtcgcgccgcggccgatcgcc
taccgggtctttcgcgcgacgccgccccgcgtgcccgtcgcgagcacggtcggcgcgggc
gacgccttcgtcgccgggctcgtcgcgagcctgacggaagcgcgcgcatggggcgacacg
ggccgccgtgcgaccgcgttcgcggccgcgaagctcgcgcgcgtcggcccgcatctgccg
gatcgtgcgacgctcgcggcgctcgccgcgcaggtcgaggtcgacactttcacgctggcc
gccgaggcggacggcgccgttcattcataa

DBGET integrated database retrieval system