KEGG   Burkholderia thailandensis E264: BTH_II0930Help
Entry
BTH_II0930        CDS       T00311                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bte  Burkholderia thailandensis E264
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BTH_II0930
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BTH_II0930
   00020 Citrate cycle (TCA cycle)
    BTH_II0930
   00620 Pyruvate metabolism
    BTH_II0930
Enzymes [BR:bte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BTH_II0930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1092822..1093961
Genome map
AA seq 379 aa AA seqDB search
MIEFTLPSMGADMDEGTLLEWKVKPGDAVKKGQVVAVVDTSKAAVDIESWQEGTVDELIV
EPGEKIPVGTPIATLLEPGETPPAVRPVRRRARPAAAVGAGARRKISPAARQRAMRGGVD
LDAVSGTGPGGSVTLADVERTSAAAAAPSEAAATGDRAREMRRVIAAAMARSKHEIPHYY
VSEPIPLGKALAWLAAENAKRSVVDRLLPAALLLKAVAVTLTRFPELNGFYRQGAFQPAG
QVHLGVAISLRQGGLIAPALLDAGTKPLTQLMRELADLTQRSRAGSLRSAELSQSTITVT
NLGDRGAAEVFGIIYPPQVALVGFGRIVERPWAEGGALGVMPVVTASVSADHRVSDGHRG
ALFLVELSEALQNPEALSR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaattcacgttgccttcgatgggcgccgacatggacgaggggacgctcctcgaa
tggaaggtcaagcccggggacgccgtgaagaagggccaggtggtggccgtcgtcgatacg
agcaaggccgccgtcgatatcgaaagctggcaggagggcacggtcgacgaactgatcgtc
gagccgggcgagaagattccggtgggcacgccgatcgcgacgctgctcgaacccggcgaa
acgccgcccgccgtcaggcccgtgcgccggcgggcgaggccggccgcggccgtcggcgcg
ggcgcgcggcgcaagatttcgccggccgcccggcagcgggcgatgcgaggcggcgtcgat
ctcgacgcggtgtcgggcaccggccccggcggctcggtgacgttggcggatgtcgagcgg
acatcggccgccgccgcggctccgagcgaggctgccgcgacgggcgaccgcgcgcgcgaa
atgaggcgcgtgatcgccgccgcgatggcgcgctcgaagcacgagatcccgcactactac
gtgtccgaaccgattccgctgggcaaggcgctcgcatggcttgcggcggagaacgcaaag
cgttccgtcgtcgaccggctgctgccggccgcgctgttgctcaaggccgtggccgtgacg
ctgacccggtttccggagctcaacggcttctatcgtcaaggggcctttcagcctgccggc
caggtgcacctcggcgtggcgatctcgctgcgccagggcggcctgatcgcgcccgcgctg
ctcgatgcgggcacgaagccgctgacccaattgatgcgcgaactcgcggacctgacgcaa
cgtagccgcgccggctcgttgcgcagcgccgagctgtcgcaatcgacgatcaccgtgacg
aatctcggcgatcgcggcgccgcggaggtgttcggcatcatctatccgccgcaggtcgcg
ctcgtggggttcgggcgaatcgtcgagcggccgtgggccgaaggcggggcgctcggggtc
atgccggtcgtgaccgccagcgttagcgccgaccatcgcgtctccgacggccatcgcggc
gcgttgttcctcgtcgagctgagcgaagcgttgcagaacccggaggcattgagcagatga

DBGET integrated database retrieval system