KEGG   Burkholderia thailandensis E264: BTH_II1216Help
Entry
BTH_II1216        CDS       T00311                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
bte  Burkholderia thailandensis E264
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BTH_II1216
Enzymes [BR:bte01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     BTH_II1216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
JCVI-Pathema: 
UniProt: 
Position
II:1439051..1440115
Genome map
AA seq 354 aa AA seqDB search
MSRVRLLSELVPGLDTLVRPLDLLERPTPVTEEPELARRWGQAGLWVKRDDLANPLYGGS
KVRTLEFFLGRARAVGADGVVTMGPYGSHQLLATAVFGRLTGFRTRGVATPQPDVPEIEL
NRRLLPAYGMEVMRCGSFAAVPATLLRARLKRLGSARPFWIPPGANHPLGVMGVVEGALE
VAQAIRAGSLPLPDDVVVPTGTCATAAGVYLGFALAGLHVRVVAVRMVPMIVTGPAKLLR
MVRQTEWLLRRYGLTATARWGALLWTNDHAGPSYGRGGLVAERARADVEQFGAFRTETTY
TAKTLALLAGGGLRQRRVLFWNTYSAIDPDPMRDAADACAPADGAPFPRCATEP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgtacgcctgctttccgaactggttccggggctcgacacgctcgtcaggccg
ctggacctgctcgagcggcccacgcccgtgaccgaggagccggaactcgcgcgccgttgg
gggcaggccggcctgtgggtcaagcgcgacgatctcgccaatccgctctacggcggcagc
aaggtccgcacgctcgagttcttcctcggccgcgcgcgcgcggtgggcgcggacggcgtc
gtcacgatggggccctacggcagccatcagttgctcgcgaccgcggtgttcggccggctg
acgggttttcgcacgcgcggcgtcgcgacgccgcagcccgacgtgccggagatcgaactg
aaccgccggctgctgcccgcgtacggcatggaggtgatgcgctgcggcagcttcgccgcc
gtgcccgcgacgctgctgcgcgcgcggctcaagcggctcggctcggcgcggccgttctgg
attccgcccggcgcgaatcatccgctcggcgtgatgggcgtcgtcgagggcgcgctcgaa
gtcgcgcaggcgatccgcgcgggcagcctgccgcttccggacgacgtcgtcgtgccgacc
ggcacctgcgcgacggcggcgggcgtctacctcggcttcgcgctcgcggggctccacgtg
cgggtcgtcgccgtgcggatggtgccgatgatcgtcaccgggccggcgaagctgctgcgc
atggtccggcagaccgagtggctgctgcgccgctacggcctgacggcgaccgcgcgctgg
ggcgcgctgctgtggacgaacgaccatgcggggccgagctacgggcggggcggcctcgtc
gccgagcgcgcgcgcgcggatgtcgagcaattcggcgcattccgcaccgaaaccacctac
accgcgaagacgctcgcgctgctcgcgggcggcggtcttcggcagcggcgagtgctgttc
tggaacacctacagcgcgatcgatcccgatccgatgcgggacgccgccgacgcgtgcgcg
cccgccgacggcgcgccctttcctcgttgcgcaaccgaaccgtag

DBGET integrated database retrieval system