KEGG   Burkholderia thailandensis E264: BTH_II1407Help
Entry
BTH_II1407        CDS       T00311                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bte  Burkholderia thailandensis E264
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BTH_II1407
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BTH_II1407
Enzymes [BR:bte01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BTH_II1407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1658816..1660117
Genome map
AA seq 433 aa AA seqDB search
MSNLIVHGGAPLRGEITPSANKNAVLPILCATLLTDQPLRLVGVPDITDVRKILDIFRTL
GSDVAIDYATGVLDLHHRATAFDPAVHRLPEEMRSSIMLVPPLLARFGVARLENDVKGCT
LGVREIDPHVEVFERFGARIERTPDSLIVRADGPLAPNHHWLDYASVTTTENFVLCAASA
NGTSTLVNAASEPHVQEFCRFLAMLGVPIEGIGTSHLSVQGGRALAGGEYRFNEDFHEIA
TFLALGAITGGDIAVRNGSPEQFPLIDRTFAKFGVRVTHENGWSHALRDGPLKVKQPFTR
NILTKVEAAPWPYLPVDLLPIFIALGVQAQGSVMFWNKVYDGAMGWTGELSKFGAHVFLS
DPHRLITFGGLPLSPARVESPYIIRVAIALLMVAASIDGRSEILNAQPIRRAHPRFVENL
RSVGANVEWTSGE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacctgatcgtccacggcggcgccccgcttcgcggagaaatcacgccgtccgcc
aacaagaacgccgtcctgcccatcctgtgcgcgacgctcctcaccgaccagccgctgcgg
ctcgtcggcgtgccggacatcaccgacgtccgcaagatcctcgacatcttccgcacgctc
ggcagcgacgtcgcgatcgactacgcgacgggcgtgctcgacctgcaccaccgcgcgacc
gcgttcgatccggccgtccaccggctgccggaggagatgcgctcgtcgatcatgctggtg
ccgccgcttctcgcgcgcttcggcgtcgcgcggctcgagaacgacgtgaagggctgcacg
ctcggcgtgcgcgagatcgatccgcacgtggaggtgttcgagcgcttcggcgcgcggatc
gaacgcacgcccgattcgctgatcgtgcgcgccgacggcccgctcgcgccgaatcatcac
tggctcgactacgcgtccgtcacgacgaccgagaatttcgtgctgtgcgcggcgtcggcg
aacggcacgtcgacgctcgtcaacgccgcgtcggagccgcacgtgcaggagttctgccgg
ttcctcgcgatgctcggcgtgccgatcgagggcatcggcacgtcgcacctgagcgttcag
ggcgggcgcgcgctcgcgggcggcgaataccgcttcaacgaggacttccacgagatcgcg
acgttcctcgcgctcggcgcgatcacgggcggcgacatcgcggtgcgcaacggctcgccc
gagcagtttccgctgatcgatcggaccttcgcgaaattcggcgtgcgggtcacgcacgag
aacggctggtcgcatgcgctgcgcgacggcccgctgaaggtcaagcagccgttcacccgc
aatatcctgacgaaggtcgaggccgcgccgtggccttacctgcccgtcgatctgctgccg
atcttcatcgcgctcggcgtgcaggcgcaaggcagcgtgatgttctggaacaaggtctac
gacggcgcgatgggctggacgggcgagctctcgaagttcggcgcgcacgtgttcctgtcc
gatccgcatcggctgatcacgttcggcgggctgccgctcagcccggcgcgcgtcgagagt
ccgtacatcatccgcgtcgcgatcgcgctcttgatggtcgcggcgagcatcgacggacgc
tcggaaatcctgaatgcgcagccgatccggcgcgcgcatccgcgcttcgtcgagaatctg
cgctcggtcggcgcgaacgtcgagtggacgagcggcgagtaa

DBGET integrated database retrieval system