KEGG   Burkholderia thailandensis E264: BTH_II1554Help
Entry
BTH_II1554        CDS       T00311                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bte  Burkholderia thailandensis E264
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bte00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BTH_II1554
Enzymes [BR:bte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BTH_II1554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1826226..1827158
Genome map
AA seq 310 aa AA seqDB search
METIAVIGSNMVDLVTYVARMPADGETLEAPNFELGCGGKGANQAVAASKLGARVAMVSK
VGDDLFAENTLRNLERFGIDIEHVRRVPGVSSGVAPIFVSPDSRNRILIVKGANRHLKPA
DIDAAAAKIAASRLVVLQLEIDIDTVYYAIDFAAARGIPVLLNPAPGAADLDFSRLAKLE
FLVPNETELALVSGMPTDTPDAIEHAARSLVERGVKHVIVTLGDKGSLLVSRAGVVRVPP
VAVDARDTTGAGDAYIGCFARHYVATLDIPAAMRLASAYAAHSVTGFGTQKSYADAATFE
RFLQTPRSGA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggagacgatcgccgtcatcggcagcaacatggtcgacctcgtgacctacgtcgcgcga
atgcccgccgacggagaaacgctcgaggcgccgaacttcgagctcggctgcggcggcaag
ggcgcgaaccaggcggttgccgcgtcgaagctgggggcgcgcgtcgcgatggtgtcgaag
gtcggcgacgatctgttcgccgagaacacgctgcgcaacctcgagcgcttcggcatcgac
atcgagcacgtgcgccgcgtgcctggcgtatcgagcggcgtcgcgccgatcttcgtgagc
cccgattcgcgcaaccggattctgatcgtcaagggtgcgaaccggcacctgaagccggcc
gacatcgacgcggccgccgcgaagatcgcagcgagccgcctcgtcgtgctgcagctcgag
atcgacatcgatacggtctactacgcgatcgacttcgccgccgcgcgcggcatcccggtg
ctgctcaatcccgcgccgggcgcggcggatctcgacttctcgcggctggcgaagctcgag
ttcctcgtgccgaacgaaaccgagctcgcgctcgtgtcagggatgccgaccgacacgccc
gacgcgatcgaacacgcggcgcgctcgctcgtcgagcgcggagtgaagcacgtgatcgtc
acgctcggcgacaaggggtcgctcctcgtgtcgcgcgcgggtgtcgtgcgcgtgccgccc
gttgccgtcgacgcgcgcgacacgacgggcgcgggcgacgcatacatcggctgcttcgcg
cgccattacgtcgcgacgctcgacatacccgccgcgatgcgcctcgcgtccgcgtatgcc
gcgcattcggtgacgggcttcggcacgcagaagtcgtacgcggacgcggcgacgttcgag
cgcttcctgcagacgccccgttccggcgcgtga

DBGET integrated database retrieval system